SecReT6
Protein ID: 91209288
SecReT6 ID120
T6SS typei1
Gene symbol-
Locus tagUTI89_C0240
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]248842..250284 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ1RFX1
KEGG IDeci:UTI89_C0240
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.00E-06, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 1.00E-06, Aligned region: 406..417
Protein Sequence: 480 a.a.     [Download]
>gi|91209288|ref|YP_539274.1| hypothetical protein UTI89_C0240 [Escherichia coli UTI89]
MAMDLRNPDVWLAHLLENLPEDKLSAALDDGNADWEFVDSEIVKLGSLAHSQLDIPELQRRGLMLLASET
KDFRLLAHLLRTLQHAGDILLASRMLAQYTEHYWTCAAPQNMAHKKRFAAQVIKRFESAVQDFAGNAATI
QRDALLGELAKLAQCWQAHNASELAKATDDLFSLFQRAFRDVAPEMTSSARSAAIAPQATTGYVPDMSPH
TVAAQPPVAATPIPQVTVENHDDKAWRDTLLKVAAILCERQPESPQGYRLRRHALWQTITSTPQAESDGR
TPLAAFPVDMMDDYLARLNNADMALWQQVEKSLLLAPYWLDGHYLSAQTALRLGYKQVADAIRDEVTDFL
ARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTVPVVQTDEELQAAKACFDENGLEAALRYLENLPEG
DPRHQFHRQFFGAQLLEEAGMVQLAQQQYRMLFRTGLHMMLSEWEPSLLKALEQKLTAEQ
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|91209055|ref|NC_007946.1|:c250284-248842 Escherichia coli UTI89 chromosome, complete genome
ATGGCAATGGACTTACGTAATCCCGATGTATGGCTTGCACACCTGCTGGAAAACCTGCCAGAAGATAAGC
TGTCCGCCGCGCTTGATGATGGCAATGCAGACTGGGAGTTTGTCGACAGCGAAATCGTCAAGCTCGGTTC
ACTGGCGCACAGCCAGCTTGATATCCCGGAACTTCAGCGCCGGGGCCTGATGCTTCTGGCCTCAGAAACC
AAAGATTTTCGCCTGCTGGCCCACTTGCTGCGTACCCTGCAACATGCCGGTGATATTCTGCTGGCCTCCA
GGATGCTGGCACAATATACAGAGCACTACTGGACATGCGCCGCACCGCAGAACATGGCCCACAAAAAACG
CTTTGCCGCCCAGGTGATAAAACGCTTTGAGTCTGCCGTTCAGGACTTTGCCGGGAATGCTGCGACAATA
CAGCGCGATGCTTTGCTGGGAGAGCTGGCAAAACTGGCACAGTGCTGGCAGGCGCACAACGCGTCTGAGC
TGGCAAAGGCGACAGACGATTTATTTTCCCTGTTTCAGCGCGCGTTTCGTGATGTAGCGCCTGAAATGAC
ATCATCTGCACGAAGCGCCGCCATTGCGCCGCAGGCCACGACCGGATATGTACCGGATATGTCACCGCAC
ACGGTTGCCGCTCAGCCTCCTGTTGCAGCCACTCCAATCCCGCAGGTCACCGTTGAAAACCACGACGATA
AAGCATGGCGCGACACCCTGCTAAAGGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGAGTCACCGCAGGG
TTACCGACTGCGCCGCCATGCGCTGTGGCAAACCATCACCAGTACCCCGCAGGCAGAAAGCGATGGCCGG
ACCCCACTGGCAGCCTTCCCTGTCGATATGATGGATGATTACCTGGCGCGGCTGAACAATGCCGACATGG
CGCTGTGGCAGCAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGGCTGGACGGTCATTACCTCTCAGC
ACAGACCGCGCTGCGCCTCGGTTATAAACAGGTGGCGGATGCTATCCGTGATGAAGTTACCGATTTTCTG
GCCCGCCTGCCCGCACTGATCAACCTGTTGTTTAACGACCGCACTCCGTTTGTGTCCGAACAGACGAAAC
AGTGGCTGGCATCATCCGGCTCAGTCAACCAGACCGTCCCGGTTGTACAGACCGATGAAGAATTACAGGC
GGCCAAGGCGTGCTTCGATGAAAACGGGCTGGAAGCCGCGCTGCGGTACCTGGAAAACCTGCCCGAAGGT
GATCCCCGCCACCAGTTTCACCGCCAGTTTTTCGGCGCGCAGTTACTGGAAGAGGCCGGTATGGTTCAGC
TTGCACAACAGCAGTACCGGATGCTCTTCAGAACAGGATTACACATGATGCTATCCGAATGGGAGCCTTC
CCTGCTGAAAGCACTGGAACAAAAACTCACGGCAGAACAGTAA