SecReT6
Protein ID: 91209291
SecReT6 ID120
T6SS typei1
Gene symbol-
Locus tagUTI89_C0243
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]253798..254562 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ1RFW8
KEGG IDeci:UTI89_C0243
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.10E-62, Aligned region: 33..237
Protein Sequence: 254 a.a.     [Download]
>gi|91209291|ref|YP_539277.1| hypothetical protein UTI89_C0243 [Escherichia coli UTI89]
MSDMSEASVFPVEPESGTPGRQYRLALRGNSLNPMIDAATPLLGMVMRLSTMNSQAMPEHLFTQVVTDVQ
AVEQLLQEQGYEPGVIVSFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIR
EPVRYQDLLEFLYLCFSLGFRGRYKVAIQQQDEFERIYQRLHHALHKLRGDAPFPLLHQKNNIQGGRYQL
IRRLTIKHVLCGGLVVLTVFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 765 bp     [Download]
>gi|91209055|ref|NC_007946.1|:c254562-253798 Escherichia coli UTI89 chromosome, complete genome
ATGAGCGATATGAGTGAAGCGTCGGTTTTTCCCGTGGAGCCGGAGAGCGGAACACCAGGACGCCAGTACC
GTCTCGCCCTTCGCGGCAACAGCCTGAATCCAATGATTGACGCCGCCACGCCGTTGCTCGGCATGGTGAT
GCGTCTGTCCACTATGAACAGTCAGGCCATGCCGGAACATCTGTTTACCCAGGTAGTAACCGATGTCCAG
GCCGTAGAGCAACTACTCCAGGAACAGGGATACGAACCGGGCGTCATTGTTTCGTTCCGTTACATTCTCT
GCACGTTTATTGATGAAGCGGCGCTGGGCAACGGCTGGTCCAACAAAAACGAATGGATCAAACAGTCGCT
GCTGGTTCATTTTCATAACGAAGCCTGGGGCGGCGAGAAAGTGTTTATCCTGCTCGAACGCCTGATCCGG
GAGCCGGTACGTTACCAGGATCTGCTGGAATTTTTATACCTCTGTTTTTCGCTCGGCTTTCGCGGGCGCT
ACAAGGTTGCCATTCAGCAACAGGATGAATTTGAGCGGATCTACCAGCGCCTGCACCATGCCCTGCACAA
ACTGCGCGGTGACGCGCCATTTCCGCTACTTCATCAGAAGAACAACATACAGGGTGGGCGTTATCAGTTA
ATCCGACGACTGACCATCAAGCATGTACTGTGCGGCGGTCTTGTTGTGCTGACCGTATTTTATCTGTTTT
ATCTGCTGCGTCTGGACAGCCAGACACAGGATATTCTGCATCAGCTCAATAAATTACTCCGATAA