SecReT6
Protein ID: 91209292
SecReT6 ID120
T6SS typei1
Gene symbol-
Locus tagUTI89_C0244
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]254567..255913 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ1RFW7
KEGG IDeci:UTI89_C0244
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.60E-142, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|91209292|ref|YP_539278.1| hypothetical protein UTI89_C0244 [Escherichia coli UTI89]
MATMKNKVIWQEGLFALPQHFQQQQRHCEYLLTRRLDALGDFFWGFTELSINTELLAQGKIMIDRAAGCM
PDGTVFSIPDQDLLPEPFQPGTLSSKESHNIYLALPVISDVINEIQGLHSAGQGTERYRLTHTRVRDFHT
DEGDEQPVGLGQLIPRIVSGADDLSAMVTLPLCRILNKNATGALVLDNTFIPTIQAVRVSGLLGAFSGEV
QGLLATRAADLAGRIGSPEQSGIADVAEFMMLQMLNRYQMQFTHRSQLHTLHPEAFYRDLVGLLGELMTF
TEGNRLPCTVEPYNHRDLTATFTRTVIPELRRALNTVLVPRAQNLPLFFSEGTWIATINDPTLLQSCKLV
LAVRARMPYDQVQRQFIQQSKVAATDKIRSVVSVQVPGIPLHTLTAAPRQLPYHEGYVYFELEKGTPAWQ
DVIKAGALALHISGSFPDLNLQLWAIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|91209055|ref|NC_007946.1|:c255913-254567 Escherichia coli UTI89 chromosome, complete genome
ATGGCAACAATGAAAAACAAAGTGATCTGGCAGGAAGGGCTGTTTGCCCTGCCGCAGCATTTTCAGCAAC
AGCAGCGTCACTGCGAGTACCTGCTGACCCGTCGTCTGGATGCACTGGGTGATTTTTTCTGGGGTTTTAC
GGAACTCTCCATCAATACAGAACTGCTTGCCCAGGGCAAAATCATGATTGACCGTGCGGCGGGCTGTATG
CCTGACGGCACCGTATTCAGCATTCCCGACCAGGATCTGCTGCCGGAACCTTTCCAGCCGGGAACCCTTT
CATCGAAAGAGAGCCACAATATTTATCTGGCGCTGCCGGTGATAAGCGACGTGATCAATGAAATCCAGGG
GTTGCACAGCGCCGGTCAGGGTACGGAGCGTTACCGCCTCACCCATACCCGCGTCCGTGATTTTCACACT
GACGAAGGCGACGAACAGCCAGTCGGTCTGGGGCAGTTGATCCCCAGGATAGTCAGCGGCGCAGATGATC
TCAGCGCGATGGTGACTCTCCCCCTGTGCCGTATCCTCAATAAAAATGCCACCGGCGCGCTGGTGCTGGA
CAACACCTTTATTCCCACCATTCAGGCCGTCCGTGTCAGCGGGTTGCTCGGGGCATTCTCCGGCGAGGTG
CAGGGACTGCTTGCCACCCGCGCCGCTGACCTGGCCGGGCGCATTGGTTCGCCTGAACAGAGCGGGATCG
CCGATGTGGCCGAATTTATGATGTTGCAGATGCTTAACCGCTATCAAATGCAGTTCACGCATCGTTCCCA
ACTGCACACGCTGCATCCGGAAGCCTTCTACCGGGATCTGGTGGGGCTGCTGGGAGAACTGATGACCTTT
ACCGAAGGTAATCGCCTGCCCTGCACCGTGGAGCCGTATAATCACCGGGATCTTACCGCGACCTTCACCA
GAACCGTGATCCCGGAACTGCGGCGCGCGCTCAATACCGTACTGGTGCCGCGTGCGCAGAATCTGCCGTT
GTTCTTTTCAGAGGGGACCTGGATCGCCACCATCAACGATCCCACATTGTTGCAGTCCTGCAAGCTGGTA
CTGGCAGTGCGCGCCAGGATGCCCTACGACCAGGTACAACGCCAGTTCATCCAGCAGTCGAAAGTGGCCG
CTACCGACAAAATCCGCAGCGTGGTCAGCGTGCAGGTGCCGGGTATTCCGCTGCACACGCTTACCGCTGC
GCCACGTCAGTTGCCATACCACGAAGGTTATGTTTACTTCGAACTGGAAAAAGGCACCCCGGCCTGGCAG
GACGTGATAAAAGCGGGCGCACTGGCGCTGCATATCTCCGGCAGCTTCCCCGATCTGAACCTCCAGCTCT
GGGCTATAAGGGGATAA