SecReT6
Protein ID: 91209294
SecReT6 ID120
T6SS typei1
Gene symbol-
Locus tagUTI89_C0246
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]256437..257729 [-]
Producthypothetical protein
NoteFha
UniProt IDQ1RFW5
KEGG IDeci:UTI89_C0246
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.00098, Aligned region: 44..108
Protein Sequence: 430 a.a.     [Download]
>gi|91209294|ref|YP_539280.1| hypothetical protein UTI89_C0246 [Escherichia coli UTI89]
MEPLMAEEKQQSRQASLTLQVMNGNELESGRAAKCLFSENGGDIGHTPECHWQVQDRAGSIAARACTVIR
HDGAYCLRCLTPGLMINLAPASSDALIRLRQGDEIQLGALALKVFLHDGAAVTYDERMATPETIVMNRDS
LADTLLTTEGQPAYPGMPFQHQLAPTVAHGFSSDPLQALQTESLMVADDPIAPRVSRPVAPASDLTGANG
INTPFMDLPPGNARHEDGDEFSAMAQYHLAVTPLLRGMECPLTLHNSQDADEFLEEAGRALQAAIKGLLS
LQQQQNSLSDKHLRPLEDNPLRLDMDYATALNVMFAEGKSPVHLAAPAAIAESLRNIRHHEEANRAAIVE
ALRVMLDAFSPGNLMRRFAQYRRSHELRQKMDDAWAWQMYSNYYDELASSRQQGFEMLFNEVYAQVYDRV
LREKQREPEA
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|91209055|ref|NC_007946.1|:c257729-256437 Escherichia coli UTI89 chromosome, complete genome
ATGGAACCACTTATGGCTGAGGAAAAACAGCAATCCCGCCAGGCCTCACTGACTTTACAGGTGATGAATG
GCAACGAACTGGAAAGCGGACGCGCCGCAAAATGCCTGTTCAGCGAAAACGGCGGTGATATTGGCCATAC
GCCGGAATGTCACTGGCAGGTACAGGACCGGGCGGGAAGCATTGCTGCGCGTGCCTGTACCGTTATCCGG
CACGACGGAGCCTATTGCCTGCGGTGCCTGACGCCGGGACTGATGATTAATCTGGCCCCGGCCTCTTCCG
ATGCGCTCATCCGCCTGCGCCAGGGGGATGAGATCCAGCTCGGCGCACTGGCGCTGAAAGTGTTTCTGCA
TGACGGTGCAGCTGTTACCTATGACGAGCGGATGGCGACCCCGGAAACGATTGTAATGAACCGCGACAGT
CTGGCGGACACCCTGCTGACCACCGAGGGACAACCGGCGTATCCGGGAATGCCGTTCCAGCATCAGCTTG
CCCCCACGGTGGCGCACGGTTTTTCCAGCGATCCGCTCCAGGCACTCCAGACGGAAAGCCTGATGGTGGC
AGATGATCCGATCGCCCCACGCGTTTCCCGGCCCGTAGCCCCCGCATCCGATCTGACAGGTGCAAACGGG
ATCAACACGCCGTTTATGGATCTGCCGCCCGGCAATGCCCGTCATGAGGACGGCGATGAATTTTCTGCCA
TGGCGCAGTACCACCTGGCCGTAACCCCGCTGCTGCGCGGTATGGAGTGTCCGCTGACGCTGCACAATTC
TCAGGATGCGGATGAGTTTCTCGAAGAGGCCGGACGGGCGTTGCAGGCCGCCATTAAGGGATTGCTGAGT
CTGCAACAACAACAGAACAGCCTGTCGGATAAACACCTGCGTCCACTAGAAGACAACCCGTTGCGCCTTG
ATATGGACTATGCCACCGCGCTGAACGTCATGTTCGCCGAGGGTAAAAGCCCGGTACATCTCGCAGCACC
TGCGGCCATCGCCGAAAGCCTGCGCAACATCCGGCATCATGAAGAGGCTAACCGGGCGGCGATTGTGGAA
GCGTTGCGTGTCATGCTGGACGCCTTTTCGCCGGGCAACCTGATGCGCCGCTTTGCGCAATACCGCCGCA
GCCATGAACTGCGCCAGAAAATGGACGACGCCTGGGCATGGCAGATGTACAGCAACTATTACGATGAGCT
GGCCTCCAGCCGACAGCAGGGATTTGAAATGCTGTTCAATGAAGTTTATGCCCAGGTCTATGACCGGGTG
CTGCGCGAAAAACAGCGGGAGCCGGAAGCATGA