SecReT6
Protein ID: 91209296
SecReT6 ID120
T6SS typei1
Gene symbol-
Locus tagUTI89_C0248
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]258747..260588 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ1RFW3
KEGG IDeci:UTI89_C0248
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.30E-190, Aligned region: 5..613
Protein Sequence: 613 a.a.     [Download]
>gi|91209296|ref|YP_539282.1| hypothetical protein UTI89_C0248 [Escherichia coli UTI89]
MAFEERYYREELDYLRQLGKLLAQEKPHLAHFLAEKEGDPDVERLMEAFAFMSGSLRQKLEDEFPEFTHG
LIRMLWANYLRPVPAMTVIAYEPKTDQLKVPVQVCRNELIRSRSEKSSLTAQKVLPDNHDKIVSSVACHF
TLARDIWLQPLRILDTRNASSLKEGIIDISFTADNNVSPAMLDLNKITFWLGNEDDYTRHQLYLWFCECL
MDAELIAGEYRLPLPDLWLEAAGFDNRDALLPWPKNVHSGYRVLQEYFCYPEAFFFFHLRDVAPLPDDFP
INAFTLRLHFNRPLPADIKLRQDSLRLHCTPAINLFTHYAEPVRPDGRMAEYPLRASHKHPDAYDIFQVS
TVTSKVKVSGTEISPGSQARVWPEFESFQHQMEYSRQREVVYWHHRTKTSLLHHGLEHSIAFVHADGSIP
GSSRFNDDVITTSLICTNRMIPARLHTGDICVAVNKNPAVASFRNVTRPTLPLWPVTDGDMHWSLISAMN
LNYLSLLDRETLIQILRTFDLPGAHHPQRARLSRQKLDAIEKLETKPVDRLFKGVPVRGLATTLWIRPDP
FICEGEIYLLGTVLSHFFALYASINSYHCLKIINTESQESWEWQEKMGQHALI
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|91209055|ref|NC_007946.1|:c260588-258747 Escherichia coli UTI89 chromosome, complete genome
GTGGCTTTTGAAGAACGTTACTACCGCGAAGAGCTGGATTATCTTCGCCAGCTAGGCAAACTGCTGGCGC
AGGAAAAACCACATCTGGCCCACTTTCTGGCCGAGAAAGAGGGTGATCCGGACGTGGAGCGTCTGATGGA
AGCCTTTGCCTTTATGTCCGGTAGCCTGCGCCAGAAACTTGAGGACGAATTCCCCGAGTTCACCCATGGG
CTGATCCGTATGCTGTGGGCAAACTATTTACGCCCGGTTCCGGCCATGACGGTTATTGCCTATGAACCCA
AAACCGATCAGTTAAAAGTCCCTGTTCAGGTCTGTCGTAATGAACTGATCAGAAGCCGCTCAGAAAAGTC
CTCCCTGACTGCTCAGAAGGTGCTGCCTGACAATCATGATAAAATCGTTTCTTCCGTAGCCTGCCATTTC
ACGCTGGCGCGCGATATCTGGCTGCAACCACTGCGCATTCTCGATACCCGCAACGCCAGCAGCCTGAAAG
AAGGCATCATAGATATCAGTTTTACCGCAGATAACAATGTCTCCCCCGCCATGCTTGACCTGAACAAAAT
CACGTTCTGGCTGGGTAATGAAGACGATTATACCCGACACCAGCTTTATCTGTGGTTTTGCGAATGCCTG
ATGGATGCGGAACTGATTGCCGGAGAGTACCGCCTGCCGCTGCCGGATCTGTGGCTGGAGGCGGCGGGTT
TTGACAACCGGGATGCTCTGCTGCCGTGGCCGAAAAATGTCCACAGCGGCTACCGCGTGCTTCAGGAGTA
TTTCTGCTATCCCGAAGCCTTCTTCTTTTTCCATCTGCGCGATGTTGCGCCGCTACCAGACGATTTCCCG
ATCAATGCGTTTACGCTGCGCCTGCACTTTAACCGCCCGTTACCTGCCGACATCAAGCTGCGCCAGGATT
CGCTGCGTCTGCACTGTACGCCAGCCATTAACCTGTTTACGCATTATGCGGAACCCGTCAGGCCGGATGG
GCGGATGGCGGAATACCCGCTGCGCGCCAGCCATAAGCATCCGGACGCCTATGACATTTTTCAGGTCAGC
ACAGTCACCAGTAAAGTCAAAGTTTCAGGTACTGAAATCAGCCCAGGTAGCCAGGCGCGTGTCTGGCCCG
AATTTGAAAGCTTCCAGCACCAGATGGAGTACAGCCGCCAGCGAGAAGTCGTCTACTGGCATCACCGGAC
TAAAACGTCCCTGCTTCACCACGGGCTTGAACACTCTATCGCCTTTGTCCATGCAGACGGTAGCATTCCG
GGCAGCTCACGGTTTAACGATGACGTGATCACCACGTCATTAATCTGTACCAACCGTATGATCCCTGCCC
GGCTGCATACCGGTGATATCTGCGTGGCCGTCAACAAAAATCCGGCAGTGGCCTCATTTCGTAATGTCAC
GCGCCCGACACTGCCGCTCTGGCCAGTCACGGACGGCGACATGCACTGGTCGCTGATTTCCGCGATGAAC
CTGAACTACCTCTCCCTGCTGGACAGGGAGACACTGATCCAGATCCTGCGGACCTTCGACCTGCCAGGTG
CTCACCATCCGCAGCGGGCCAGACTGTCACGCCAGAAACTGGATGCCATAGAAAAACTCGAAACCAAACC
TGTTGACAGGTTGTTTAAAGGCGTACCGGTTCGCGGGCTGGCGACCACGCTGTGGATACGTCCCGATCCG
TTTATCTGCGAAGGTGAAATTTATCTTCTGGGTACCGTGCTCTCGCACTTCTTTGCCCTCTACGCCAGCA
TCAATTCGTACCACTGTCTGAAAATCATTAACACGGAAAGTCAGGAGTCCTGGGAATGGCAGGAGAAAAT
GGGCCAGCACGCCCTGATATAG