SecReT6
Protein ID: 91209301
SecReT6 ID120
T6SS typei1
Gene symbol-
Locus tagUTI89_C0253
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]264479..266461 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ1RFV8
KEGG IDeci:UTI89_C0253
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.00E-64, Aligned region: 34..328
Phage_base_V [PF04717], Evalue: 1.30E-26, Aligned region: 367..459
Gp5_C [PF06715], Evalue: 6.20E-05, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 6.20E-05, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 6.20E-05, Aligned region: 546..563
Gp5_C [PF06715], Evalue: 6.20E-05, Aligned region: 567..584
Protein Sequence: 660 a.a.     [Download]
>gi|91209301|ref|YP_539287.1| hypothetical protein UTI89_C0253 [Escherichia coli UTI89]
MSLKGLRFTLEVDGQEPDTFAVVNFRLIQNQSYPFVMSVDVASDSFMQTAEMLLEKNATLTIWQGVIPLR
YVTGVVAGFGMQENNGWQMRYHLRIEPPLWRCGLRRNFRIFQQQDIRTISATLLNENGVTEWTPLFYEDH
PAREFCVQYGESDLAFLARLWAEEGIFFFERFAADSPEQKLTLCDDVAGLSQAGELPFNPDTSAGAETEC
VSMFRYEAHVRPSSVQSQDYTFKVPDWPGMYEQQGESLNGQLEQYEIFDYPGRYKDEQHGKDFTLYRMES
LRSDAEKATGQSNSPKLWPGTWFTLTGHPQKMLNREWQVVQSILSGDQPQALHGSQGRGTTLGNQLEVIP
ADRTWRPRLQSKPKVDGPQSAIVTGPAGEEIFCDEHGRVRVKFHWDRYNPATEASSCWVRVSQAWAGPGF
GNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHEDNRSPGSLPGTKTQMTIRSKTYKGSGFNELRFEDATG
GEQVYIHAQKNMDTEVLNNRTTDVKADHTETIGNDQKITVGLGQTVNVGSKKEGGHDQKVTVANDQHLTI
KNDRHKVVNNNQTSKVTGTDTEEVVKKQSIKIGDNYELKVEHGTNIISGDSIELICGQGESGTCSIKLEK
TGKIIIRGTEFLFEATGPVDIKGKDIHLNG
 
Nucleotide Sequence: 1983 bp     [Download]
>gi|91209055|ref|NC_007946.1|:264479-266461 Escherichia coli UTI89 chromosome, complete genome
ATGTCCTTAAAAGGTCTTCGCTTTACGCTGGAGGTTGACGGCCAGGAGCCGGACACCTTTGCAGTGGTGA
ATTTCCGGTTAATCCAGAACCAGTCTTATCCGTTTGTGATGAGTGTGGATGTCGCCAGCGATTCTTTTAT
GCAGACGGCGGAGATGCTGCTGGAGAAGAACGCAACGCTGACTATCTGGCAGGGTGTCATCCCGCTGCGT
TATGTCACCGGCGTGGTGGCGGGCTTTGGCATGCAGGAGAACAACGGCTGGCAGATGCGTTATCACCTGC
GTATTGAGCCGCCGTTATGGCGGTGCGGGCTGCGGCGGAACTTCCGTATCTTCCAGCAGCAGGATATCCG
GACGATATCGGCCACATTACTGAACGAGAACGGCGTCACAGAGTGGACGCCGCTGTTTTATGAGGACCAT
CCGGCGCGGGAGTTCTGTGTGCAGTACGGGGAGTCGGACCTGGCGTTTCTGGCGCGGCTGTGGGCGGAGG
AGGGGATTTTCTTCTTTGAGCGGTTTGCGGCGGACAGTCCGGAGCAGAAGCTGACGCTGTGCGACGATGT
GGCGGGGCTGTCACAGGCGGGGGAGCTTCCGTTTAACCCGGACACATCGGCAGGAGCGGAGACGGAGTGT
GTCAGTATGTTCCGTTATGAGGCGCATGTCCGCCCGTCATCGGTGCAGAGCCAGGATTACACGTTTAAGG
TGCCGGACTGGCCGGGGATGTATGAGCAGCAGGGTGAGAGCCTGAACGGACAGCTTGAACAGTATGAAAT
ATTTGATTATCCGGGAAGGTACAAGGATGAACAGCACGGCAAGGATTTCACGCTGTACCGGATGGAGAGC
CTGCGCAGTGATGCGGAAAAGGCCACAGGGCAGAGTAATTCGCCGAAGCTGTGGCCGGGGACGTGGTTTA
CGCTGACGGGGCATCCGCAGAAGATGCTGAACCGTGAATGGCAGGTGGTACAGAGCATTCTGTCAGGAGA
CCAGCCGCAGGCGCTTCACGGCAGCCAGGGGAGAGGAACCACGCTGGGAAATCAGTTAGAGGTGATACCG
GCGGACCGGACGTGGCGTCCACGGCTGCAAAGCAAACCGAAGGTGGACGGGCCACAGAGCGCCATTGTCA
CCGGGCCTGCGGGAGAGGAAATCTTCTGTGATGAACATGGCCGGGTACGGGTGAAGTTTCACTGGGACAG
GTATAACCCGGCAACGGAGGCGAGTTCGTGCTGGGTGAGGGTGTCACAGGCGTGGGCGGGGCCGGGGTTT
GGTAACCTGGCGATACCGCGCGTGGGCCAGGAGGTGATTGTTGACTTCCTGAACGGGGACCCGGACCAGC
CGATAATCATGGGGCGGACGTACCATGAGGACAACCGTTCGCCGGGGAGCCTGCCGGGGACGAAGACGCA
GATGACGATACGGTCGAAGACCTATAAAGGAAGCGGCTTTAATGAACTGCGGTTTGAAGACGCCACGGGC
GGTGAACAGGTCTATATCCACGCGCAGAAGAACATGGATACGGAGGTGCTGAATAATCGGACGACGGATG
TGAAGGCTGACCACACGGAGACCATTGGTAACGACCAGAAGATAACGGTGGGGTTGGGCCAGACGGTGAA
TGTGGGGAGCAAAAAGGAAGGTGGTCATGACCAGAAAGTGACGGTAGCGAACGATCAGCATCTCACGATA
AAAAATGACCGGCACAAGGTTGTAAATAACAACCAGACAAGCAAGGTGACGGGAACTGATACCGAAGAAG
TCGTCAAAAAACAGAGTATTAAAATAGGTGATAATTACGAACTGAAAGTTGAGCATGGTACAAATATCAT
ATCTGGGGACAGTATTGAGCTAATTTGTGGGCAGGGAGAGAGCGGGACTTGTTCCATAAAACTGGAGAAA
ACAGGAAAGATAATAATACGGGGGACGGAGTTTCTATTTGAGGCTACCGGTCCTGTAGATATTAAAGGAA
AAGATATTCATCTGAACGGATAG