SecReT6
Protein ID: 91783716
SecReT6 ID122
T6SS typei3
Gene symbol-
Locus tagBxe_A2098
StrainBurkholderia xenovorans LB400
Repliconchromosome I [GenBank: NC_007951] [Browse all T6SS(s) in this replicon]
Location [Strand]2609791..2610888 [-]
Productcytoplasmic protein
NoteTssA
UniProt IDQ13YG9
KEGG IDbxe:Bxe_A2098
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.50E-22, Aligned region: 69..128
ImpA-rel_N [PF06812], Evalue: 4.50E-22, Aligned region: 204..221
Protein Sequence: 365 a.a.     [Download]
>gi|91783716|ref|YP_558922.1| cytoplasmic protein [Burkholderia xenovorans LB400]
MSNSRKSSLQKPERIKAAPSHDWMAPVDAAAPCGIDLEYDPEFVVLAARMTARQEAQYGDFVGSPEPVNW
SDVDRDCRRLMVRSKDMRLAVLFARCRTRLSGAAGLAEGVGLLAAWLAAFPEQIHPQPGVDADREAALEI
RMNALQALTDADGLLADVREIALTKSTATRLQMRDIERAFAQPRPSDALAPESVTRQLDDLRSQQQETLT
GFDEAFASLAAIDAWSREHLGMHAPDLSTLTRLLRHVAQGDARPVRAKAGTATIDPPSVEQRVEDATRDS
PAAREAQTVHADIDMSAGERAGTAAVDRHAALELIRQAREWFEKSEPSSPVPLLLRRAELLVGKRYAEVV
KAIPAELLVQWDSEA
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|91781384|ref|NC_007951.1|:c2610888-2609791 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGAGCAATAGCAGAAAATCCTCCCTCCAGAAACCCGAACGGATCAAGGCCGCCCCGTCGCATGACTGGA
TGGCGCCGGTGGACGCTGCCGCGCCGTGCGGGATCGACCTCGAATACGATCCGGAATTCGTCGTTCTCGC
GGCGAGAATGACCGCGAGGCAGGAAGCGCAATACGGCGATTTCGTAGGGTCGCCGGAACCCGTCAACTGG
AGCGACGTCGATCGCGACTGCCGGCGTCTGATGGTGCGCAGCAAGGACATGCGCCTCGCTGTGCTGTTCG
CGCGCTGCCGCACCCGGCTCAGCGGCGCGGCCGGTCTTGCCGAGGGCGTTGGCCTGCTGGCCGCGTGGCT
GGCCGCGTTTCCCGAGCAGATTCACCCGCAGCCCGGCGTCGACGCGGATCGCGAGGCCGCGCTCGAAATC
CGCATGAACGCCTTGCAGGCGCTGACGGACGCGGACGGCCTGCTCGCGGATGTGCGCGAAATCGCGTTGA
CGAAGTCGACTGCGACGCGCCTTCAGATGCGCGACATTGAACGGGCGTTTGCGCAGCCTCGCCCGAGCGA
TGCGCTCGCGCCGGAATCGGTGACGCGGCAACTCGACGATCTGCGTTCGCAGCAGCAGGAAACGCTGACG
GGTTTCGACGAGGCCTTCGCAAGCCTGGCCGCGATCGACGCATGGAGCCGGGAACACCTGGGCATGCACG
CGCCGGATCTGTCGACGCTGACGCGGTTGCTCCGGCACGTCGCGCAGGGCGACGCGCGCCCGGTGCGGGC
GAAGGCCGGGACCGCGACGATCGACCCGCCCAGCGTCGAACAACGCGTGGAAGATGCGACTCGGGATTCC
CCGGCCGCGCGCGAAGCGCAGACAGTACACGCGGATATTGATATGTCCGCAGGCGAGCGCGCCGGCACGG
CCGCCGTAGATCGCCATGCCGCGCTCGAACTGATCAGGCAGGCGCGCGAGTGGTTTGAGAAAAGCGAGCC
GAGCAGTCCGGTTCCGTTGCTGCTCAGGCGTGCTGAGCTGCTGGTGGGCAAGCGGTACGCGGAAGTGGTG
AAGGCTATTCCCGCTGAACTGCTCGTTCAGTGGGATAGCGAGGCCTGA