SecReT6
Protein ID: 91783718
SecReT6 ID122
T6SS typei3
Gene symbol-
Locus tagBxe_A2096
StrainBurkholderia xenovorans LB400
Repliconchromosome I [GenBank: NC_007951] [Browse all T6SS(s) in this replicon]
Location [Strand]2612313..2615063 [+]
ProductClpA/B-type chaperone, ATPase subunit ClpB, heat shock protein
NoteTssH
UniProt IDQ13YG7
KEGG IDbxe:Bxe_A2096
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.20E-37, Aligned region: 230..252
AAA_2 [PF07724], Evalue: 2.20E-37, Aligned region: 620..786
AAA [PF00004], Evalue: 8.80E-20, Aligned region: 232..363
AAA [PF00004], Evalue: 8.80E-20, Aligned region: 625..709
AAA_5 [PF07728], Evalue: 7.50E-14, Aligned region: 232..256
AAA_5 [PF07728], Evalue: 7.50E-14, Aligned region: 624..740
ClpB_D2-small [PF10431], Evalue: 9.30E-14, Aligned region: 792..866
Sigma54_activat [PF00158], Evalue: 1.70E-07, Aligned region: 228..249
Sigma54_activat [PF00158], Evalue: 1.70E-07, Aligned region: 624..723
AAA_16 [PF13191], Evalue: 2.30E-07, Aligned region: 32..75
AAA_16 [PF13191], Evalue: 2.30E-07, Aligned region: 209..248
AAA_16 [PF13191], Evalue: 2.30E-07, Aligned region: 274..310
AAA_16 [PF13191], Evalue: 2.30E-07, Aligned region: 472..533
AAA_16 [PF13191], Evalue: 2.30E-07, Aligned region: 620..666
AAA_16 [PF13191], Evalue: 2.30E-07, Aligned region: 689..712
AAA_16 [PF13191], Evalue: 2.30E-07, Aligned region: 784..859
AAA_19 [PF13245], Evalue: 5.10E-07, Aligned region: 230..259
AAA_19 [PF13245], Evalue: 5.10E-07, Aligned region: 622..646
AAA_22 [PF13401], Evalue: 1.40E-06, Aligned region: 232..328
AAA_22 [PF13401], Evalue: 1.40E-06, Aligned region: 623..647
AAA_22 [PF13401], Evalue: 1.40E-06, Aligned region: 686..712
AAA_25 [PF13481], Evalue: 1.90E-06, Aligned region: 232..269
AAA_25 [PF13481], Evalue: 1.90E-06, Aligned region: 622..652
AAA_29 [PF13555], Evalue: 4.40E-05, Aligned region: 224..250
AAA_29 [PF13555], Evalue: 4.40E-05, Aligned region: 622..649
IstB_IS21 [PF01695], Evalue: 8.10E-05, Aligned region: 224..258
IstB_IS21 [PF01695], Evalue: 8.10E-05, Aligned region: 624..644
IstB_IS21 [PF01695], Evalue: 8.10E-05, Aligned region: 694..721
AAA_17 [PF13207], Evalue: 8.70E-05, Aligned region: 232..251
AAA_17 [PF13207], Evalue: 8.70E-05, Aligned region: 624..662
Zeta_toxin [PF06414], Evalue: 0.0002, Aligned region: 232..252
Zeta_toxin [PF06414], Evalue: 0.0002, Aligned region: 617..664
NACHT [PF05729], Evalue: 0.00021, Aligned region: 232..259
NACHT [PF05729], Evalue: 0.00021, Aligned region: 624..652
AAA_18 [PF13238], Evalue: 0.00059, Aligned region: 232..249
AAA_18 [PF13238], Evalue: 0.00059, Aligned region: 625..656
AAA_14 [PF13173], Evalue: 0.0027, Aligned region: 285..312
AAA_14 [PF13173], Evalue: 0.0027, Aligned region: 623..711
Clp_N [PF02861], Evalue: 0.0037, Aligned region: 27..67
NTPase_1 [PF03266], Evalue: 0.01, Aligned region: 232..256
NTPase_1 [PF03266], Evalue: 0.01, Aligned region: 624..646
Hpr_kinase_C [PF07475], Evalue: 0.01, Aligned region: 232..243
Hpr_kinase_C [PF07475], Evalue: 0.01, Aligned region: 622..642
Protein Sequence: 916 a.a.     [Download]
>gi|91783718|ref|YP_558924.1| ClpA/B-type chaperone, ATPase subunit ClpB, heat shock protein [Burkholderia xenovorans LB400]
MAISRQALFGKLGTTLYRSIESATAFCKLRGNPYIELVHWLHQLLQQPDSDLHRLVRHCGIERETLDRDM
ARALAALPAGASSISDFSHHVELAVERAWVLATLSFNDRRIRSAWLVAALVQTPELRRVLLSISPAFGKL
SVVGLDEALPAYMENSPEAAEAPYDNSNFSTAVPGEASHALPAQSKGSPLEQFCTDLTVRAHSGEIDPVV
GRELEIRTMIDVLLRRRQNNPLLTGEAGVGKTAVVEGLACAIATGNVPPRLVGVRLLSLDVGALLAGASM
KGEFELRLRGVLEAALKSAVPVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGAIRMIGATTWAEYKR
HIEKDAALTRRFQVLQVRQPQEPAAIDMVRGLANTFSRHHGVVVRDQAIRAAVRLSHRYIPSRQLPDKAI
SLLDTACARVALSQHAPPRELQDARQRVLAARVESELLVAESRIGLDTASALAAARTRIGELVAVEERIE
ARWKAQLAAAQALLAARDAALGADHGAPHTGANSDACASPDSLKDLERALTQLQGDAPLVFPEVSEAIVA
EVVSDWTGIPVGRMVTDEVAAVQSLPATLEARVIGQPDALRQIGERVQTARAGLTDPKKPLGVFLLAGPS
GVGKTETALALAEALYGGEQNLITVNMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLD
EIEKAHRDVHEMFFQVFDKGYMEDGDGRYIDFRNTTILLTSNAGSELIASLCADAPLPPDAEGLREALTP
ALLNAFPAAFLGRVTVVPYRPLAHESLARIVRLHLDRVVTRMAQVHDIALAYSGQVVDYIVGRCLVQETG
ARVLIGFIEQHVLPRLSALWLDALASKQPITRIEIGVVDASAPPTAALAFPCTYAHAPAMPAAAATPSTL
SVAQVD
 
Nucleotide Sequence: 2751 bp     [Download]
>gi|91781384|ref|NC_007951.1|:2612313-2615063 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGGCGATTTCACGTCAGGCGCTTTTCGGCAAGCTTGGAACCACGCTGTACAGAAGCATCGAGTCCGCCA
CGGCCTTTTGCAAGCTGCGCGGCAACCCTTATATCGAGCTCGTGCACTGGCTGCATCAGTTGCTGCAACA
ACCCGACTCGGACCTGCATCGGCTCGTGCGGCATTGCGGTATCGAGCGCGAAACACTGGATCGCGATATG
GCCCGCGCGCTGGCCGCGCTGCCGGCAGGCGCCAGTTCGATCAGCGATTTCTCGCATCACGTGGAACTGG
CCGTCGAGCGGGCCTGGGTGCTCGCCACGCTCAGCTTCAATGACCGGCGTATCCGCAGCGCCTGGCTCGT
CGCCGCACTCGTGCAGACGCCGGAATTGCGCCGCGTGCTGCTTTCCATCTCGCCGGCGTTCGGCAAGCTA
TCTGTCGTGGGTCTGGACGAAGCGCTGCCGGCCTATATGGAGAATTCGCCCGAAGCCGCCGAGGCGCCCT
ACGACAACAGCAATTTTTCAACCGCGGTGCCGGGCGAGGCTTCTCACGCCCTTCCCGCGCAATCGAAAGG
GTCGCCGCTCGAACAGTTCTGCACCGACCTCACCGTGCGTGCGCACAGCGGCGAAATCGATCCGGTGGTC
GGCCGCGAACTGGAAATTCGCACCATGATCGACGTGCTGCTGCGCCGGCGCCAGAACAATCCGTTGCTGA
CCGGCGAGGCCGGCGTCGGCAAGACCGCGGTCGTCGAAGGGCTCGCCTGCGCGATCGCCACCGGCAACGT
GCCGCCCAGGCTGGTGGGCGTGCGCCTCCTGAGCCTCGACGTGGGCGCGCTGCTCGCCGGCGCCAGCATG
AAGGGCGAATTCGAGTTGCGTTTGAGAGGCGTGCTGGAAGCCGCGCTGAAGTCGGCCGTACCGGTGATCC
TGTTCGTCGACGAAATCCATACGCTGATCGGCGCGGGCGGCCAGGCCGGCACGGGCGACGCGGCCAATCT
GCTGAAACCCGCGCTCGCGCGCGGCGCGATCCGCATGATCGGCGCGACCACCTGGGCGGAATACAAACGG
CACATCGAAAAAGACGCGGCGCTCACGCGGCGCTTCCAGGTCCTGCAGGTGCGGCAGCCGCAGGAACCGG
CGGCGATCGACATGGTGCGCGGCCTCGCGAACACGTTCTCGCGGCATCACGGCGTTGTCGTGCGTGACCA
GGCGATCCGCGCGGCGGTGAGGCTGTCGCATCGCTACATTCCCTCCCGCCAGTTGCCGGACAAGGCAATC
AGTCTTCTCGACACGGCGTGCGCGCGCGTCGCGCTTTCGCAGCATGCACCGCCGCGAGAATTGCAGGACG
CGCGTCAACGCGTGCTGGCCGCGCGCGTCGAAAGCGAGTTGCTCGTCGCGGAATCGCGTATCGGGCTCGA
TACCGCGAGCGCATTGGCGGCGGCCCGAACGCGCATCGGCGAACTGGTCGCTGTCGAAGAGCGCATCGAA
GCGCGCTGGAAAGCACAACTCGCGGCGGCGCAAGCCTTGCTCGCCGCCCGTGATGCGGCGCTCGGGGCCG
ATCACGGCGCGCCGCACACCGGCGCGAACAGTGACGCATGCGCGTCGCCCGATTCGCTCAAGGATCTGGA
GCGCGCCCTCACGCAATTGCAGGGCGATGCGCCGCTGGTGTTTCCCGAGGTGAGCGAAGCAATCGTCGCC
GAAGTGGTATCGGATTGGACCGGCATTCCCGTGGGCCGCATGGTCACCGACGAAGTGGCCGCCGTGCAAT
CACTGCCCGCCACGCTCGAAGCCCGCGTGATCGGCCAGCCCGATGCATTGCGTCAGATCGGCGAGCGGGT
GCAAACCGCACGCGCCGGGCTCACGGATCCGAAGAAGCCGCTCGGCGTATTCCTGCTCGCGGGCCCTTCC
GGTGTGGGCAAGACCGAGACGGCGCTCGCCCTCGCGGAGGCGCTCTACGGCGGCGAGCAGAACCTGATCA
CCGTCAATATGAGCGAGTACCAGGAGGCGCACACGGTCTCCGGACTGAAAGGCGCCCCGCCCGGCTATGT
CGGCTACGGCGAAGGCGGTGTGCTCACGGAAGCCGTGCGGCGGCGCCCCTATTCCGTGGTGCTGCTCGAC
GAAATCGAGAAAGCCCATCGCGACGTGCACGAAATGTTCTTCCAGGTGTTCGACAAAGGCTATATGGAAG
ACGGCGACGGCCGCTATATCGATTTCCGCAACACCACGATCCTGCTCACGAGCAACGCCGGCTCGGAGCT
GATCGCGAGCCTGTGCGCGGACGCGCCGCTCCCGCCCGATGCCGAAGGTCTGCGCGAAGCTCTCACGCCC
GCGTTGCTCAACGCATTTCCCGCGGCGTTTCTCGGCCGCGTCACCGTGGTGCCGTACCGGCCGCTCGCGC
ATGAATCGCTTGCGCGCATCGTGCGGCTGCATCTGGACCGCGTCGTCACTCGCATGGCGCAGGTTCACGA
CATTGCGCTTGCCTACAGCGGGCAAGTGGTCGACTACATCGTTGGCAGATGCCTGGTTCAGGAAACCGGA
GCCCGCGTGCTGATTGGCTTTATCGAACAACACGTGCTGCCGCGCCTTTCCGCGTTATGGCTCGACGCGT
TGGCGTCGAAACAGCCCATCACGCGTATTGAAATCGGCGTGGTCGACGCCAGCGCGCCACCCACTGCCGC
TCTCGCTTTCCCCTGCACGTATGCGCATGCCCCGGCAATGCCGGCAGCAGCCGCAACGCCGTCCACCCTT
TCCGTCGCGCAGGTTGACTGA