SecReT6
Protein ID: 91783719
SecReT6 ID122
T6SS typei3
Gene symbol-
Locus tagBxe_A2095
StrainBurkholderia xenovorans LB400
Repliconchromosome I [GenBank: NC_007951] [Browse all T6SS(s) in this replicon]
Location [Strand]2615103..2615651 [+]
Productcytoplasmic protein
NoteTssB
UniProt IDQ13YG6
KEGG IDbxe:Bxe_A2095
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.40E-59, Aligned region: 11..164
Protein Sequence: 182 a.a.     [Download]
>gi|91783719|ref|YP_558925.1| cytoplasmic protein [Burkholderia xenovorans LB400]
MSVPSSSQKFIALNRAPRVQIEYDVEVYGSEKKVELPFVMGVLSDLSGKPVEALPPVAERGFLDIDIDNF
DERMKAIGPRVAFAVPNTLSGDGQLVVDMTFESIEDFSPAAVARKVDSLRQLLEARTQLANLQTYMDGKS
GAESLVNRLLQDPALLKSLAATPKPQVAHTAGDTVEPADATR
 
Nucleotide Sequence: 549 bp     [Download]
>gi|91781384|ref|NC_007951.1|:2615103-2615651 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGTCCGTTCCCAGCAGTTCGCAGAAATTCATCGCGCTCAATCGGGCGCCACGTGTGCAGATCGAGTACG
ACGTCGAAGTCTACGGCTCCGAGAAGAAAGTCGAATTGCCGTTCGTCATGGGCGTGCTGTCCGACCTCTC
CGGCAAGCCCGTCGAAGCGCTGCCGCCGGTCGCCGAGCGCGGTTTCCTCGATATCGATATCGACAATTTC
GACGAGCGGATGAAGGCGATCGGCCCGCGCGTCGCATTCGCCGTGCCGAACACGCTTTCGGGCGACGGAC
AACTGGTGGTGGATATGACTTTCGAGAGCATTGAAGACTTCTCGCCGGCAGCCGTCGCCCGCAAGGTCGA
TTCGCTGCGGCAACTGCTCGAAGCGCGCACGCAACTCGCCAACCTGCAAACGTATATGGACGGCAAGTCC
GGTGCGGAATCGCTCGTCAACAGGCTGCTGCAGGATCCGGCGTTGCTGAAATCGCTCGCGGCCACGCCGA
AGCCGCAGGTTGCGCACACCGCCGGCGACACAGTAGAACCCGCGGACGCGACCCGCTGA