SecReT6
Protein ID: 91783720
SecReT6 ID122
T6SS typei3
Gene symbol-
Locus tagBxe_A2094
StrainBurkholderia xenovorans LB400
Repliconchromosome I [GenBank: NC_007951] [Browse all T6SS(s) in this replicon]
Location [Strand]2615685..2617178 [+]
Productcytoplasmic protein
NoteTssC
UniProt IDQ13YG5
KEGG IDbxe:Bxe_A2094
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.20E-193, Aligned region: 64..491
Protein Sequence: 497 a.a.     [Download]
>gi|91783720|ref|YP_558926.1| cytoplasmic protein [Burkholderia xenovorans LB400]
MAKQQIQAAAADVHTQSDFTQLLNQEFRPKTEQAREAVEHAVQTLAEQALLQSATISDDAYKSIEAIIAQ
IDHKLSEQINLILHHAEFQKLESAWRGMHHLVSNTETDERLKIRFMDVSKDELRRTMKRYKGIAWDQSPL
FKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGSIAKVAAAAHTPFISGASPSVLQMESWQELANP
RDLTKIFTQNLEYAPWNSLRNSEDARYVGLAMPRFLARLPYGVRTNPVDEFDFEEDTNGSDHRRYAWANA
AYAMGVNINRSFKLYGWCSLIRGVESGGTVENLPCHSFPTDDGGVDMKCPTEIAISDRREAELSKNGFIP
LIHRKNTDHATFIGAQSLQKPAEYYDADATANANLSARLPYLFACSRFAHYLKCIVRDKIGAFKEREEMQ
RWLNEWVMHYVDADPANSSQETKARRPLAAAEVVVDEVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVAKL
PSIKEAA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|91781384|ref|NC_007951.1|:2615685-2617178 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGGCAAAACAGCAAATACAGGCCGCCGCCGCGGACGTACATACGCAGTCCGACTTTACCCAGCTGCTCA
ACCAGGAATTCAGGCCGAAAACCGAACAGGCTCGCGAGGCTGTCGAACACGCCGTGCAAACCCTCGCCGA
GCAGGCGTTGCTGCAGTCGGCCACGATCAGCGACGACGCGTACAAGAGTATCGAGGCGATCATCGCCCAG
ATCGATCACAAGCTTTCCGAACAGATCAATCTGATTCTGCACCATGCCGAGTTCCAGAAACTGGAGTCGG
CCTGGCGTGGCATGCACCATCTGGTCTCCAACACCGAAACCGACGAACGCCTGAAGATCCGCTTCATGGA
TGTGTCGAAAGACGAGTTGCGGCGCACGATGAAACGCTACAAAGGCATTGCCTGGGATCAGAGCCCGCTC
TTCAAGCAGATCTACGAAGAAGAGTATGGCCAGCTCGGCGGCGAGCCTTATGGCTGCCTCGTGGCCGACT
ACTATTTCGACCATACGCCGCCCGACGTCGATCTGCTCGGCTCGATCGCCAAAGTGGCCGCGGCGGCGCA
CACGCCGTTCATTTCCGGCGCGTCGCCTTCGGTGCTGCAGATGGAATCGTGGCAGGAGCTCGCCAATCCG
CGCGACCTGACCAAGATCTTCACGCAGAACCTCGAGTACGCACCGTGGAACTCGTTGCGCAATAGCGAAG
ACGCGCGTTATGTCGGCCTCGCCATGCCGCGTTTCCTCGCCCGCCTGCCCTACGGCGTGAGAACCAACCC
CGTCGACGAATTCGATTTCGAAGAGGACACCAACGGCTCCGATCACCGCCGCTACGCATGGGCCAACGCG
GCCTATGCAATGGGTGTGAATATCAACCGTTCGTTCAAGCTGTACGGCTGGTGCTCGCTGATCCGCGGCG
TCGAATCGGGCGGCACGGTCGAAAATCTGCCGTGCCACTCATTCCCCACCGACGACGGCGGCGTCGACAT
GAAATGCCCGACCGAGATCGCCATCTCGGACCGGCGCGAGGCCGAGTTGTCGAAGAACGGCTTCATCCCG
TTGATCCACCGCAAGAACACCGATCACGCCACGTTCATCGGTGCGCAGTCCTTGCAGAAGCCGGCCGAAT
ACTACGACGCCGACGCCACCGCGAATGCGAACCTGTCCGCGCGCCTGCCGTATCTGTTTGCCTGCTCGCG
CTTCGCGCATTACCTCAAGTGCATCGTGCGCGACAAGATCGGCGCGTTCAAGGAACGCGAGGAAATGCAG
CGCTGGCTGAACGAGTGGGTCATGCATTACGTCGACGCGGACCCCGCCAACTCGTCGCAGGAAACCAAGG
CGCGGCGGCCGCTCGCCGCCGCCGAGGTGGTAGTGGACGAAGTGGAAGGCAACCCCGGCTACTACCAGGC
GAAGTTCTTCCTGCGCCCGCACTTCCAGCTCGAAGGGCTGACGGTGTCGTTGCGCCTCGTCGCGAAACTG
CCGTCCATCAAGGAAGCGGCTTGA