SecReT6
Protein ID: 91783723
SecReT6 ID122
T6SS typei3
Gene symbol-
Locus tagBxe_A2091
StrainBurkholderia xenovorans LB400
Repliconchromosome I [GenBank: NC_007951] [Browse all T6SS(s) in this replicon]
Location [Strand]2618277..2618759 [+]
Productcytoplasmic protein
NoteTssD
UniProt IDQ13YG2
KEGG IDbxe:Bxe_A2091
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-42, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|91783723|ref|YP_558929.1| cytoplasmic protein [Burkholderia xenovorans LB400]
MAQDIFLKINGIDGESPDAAHKNEIEVKSWGWRVSQQANMHAGSGGGAGKATVDDLEFEHLVDRASPNLM
KYCLTGKHVDQAVLVVRKAGGNPLEFLKITMSDVIVTQVHPSGSNGDDGIREHVRLSFAKVRQEYVVQNA
QGGSGGAVTAGYDIKGNKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|91781384|ref|NC_007951.1|:2618277-2618759 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGGCACAAGACATTTTTCTCAAGATCAACGGCATCGACGGAGAATCGCCGGACGCTGCGCACAAGAACG
AGATCGAGGTGAAGAGCTGGGGCTGGCGCGTGTCCCAGCAGGCGAACATGCATGCGGGCTCCGGTGGCGG
CGCGGGAAAGGCCACGGTGGATGACCTCGAGTTCGAACACCTCGTGGATCGGGCAAGCCCGAACCTGATG
AAATACTGCCTGACGGGCAAGCACGTCGACCAGGCTGTGCTGGTGGTGCGCAAAGCCGGTGGCAATCCGC
TCGAATTTCTGAAGATCACCATGAGCGATGTGATCGTCACTCAGGTTCATCCGTCCGGCAGCAACGGCGA
CGACGGTATTCGCGAGCACGTTCGCCTGTCGTTTGCGAAGGTCAGGCAGGAATACGTGGTTCAGAACGCA
CAAGGCGGTAGCGGCGGCGCCGTGACGGCCGGGTACGACATCAAGGGCAACAAGGAGGCTTAA