SecReT6
Protein ID: 91783724
SecReT6 ID122
T6SS typei3
Gene symbol-
Locus tagBxe_A2090
StrainBurkholderia xenovorans LB400
Repliconchromosome I [GenBank: NC_007951] [Browse all T6SS(s) in this replicon]
Location [Strand]2618874..2619374 [+]
Productouter membrane lipoprotein
NoteTssJ
UniProt IDQ13YG1
KEGG IDbxe:Bxe_A2090
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-43, Aligned region: 15..160
Protein Sequence: 166 a.a.     [Download]
>gi|91783724|ref|YP_558930.1| outer membrane lipoprotein [Burkholderia xenovorans LB400]
MRLITLVIALAFASALTACASSDPKTAKEPVKLELSVVASAGVNPDDQKRAAPIVVRVYELKTDGAFNSA
DFFSLQDKDKTVLAEDLVTRTQFQLRPGESRSIRTRADPATTVVGVLAAYRDLPNSVWRAVYPLPAAPDA
AWYRNAPKLKLTIDLEANAIRITEIK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|91781384|ref|NC_007951.1|:2618874-2619374 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGCGTCTCATCACCCTTGTTATCGCTCTCGCTTTTGCCTCCGCGCTGACCGCGTGCGCCAGCAGCGATC
CAAAGACCGCGAAGGAACCCGTCAAGCTCGAACTGTCGGTGGTGGCGTCCGCGGGCGTCAATCCGGACGA
CCAGAAGCGCGCGGCGCCGATCGTCGTGCGCGTCTATGAATTGAAAACCGACGGCGCATTCAATTCCGCC
GACTTTTTTTCATTGCAGGACAAGGACAAAACCGTTCTCGCGGAGGATCTGGTGACGCGGACGCAATTCC
AGTTGCGGCCAGGGGAGAGCAGATCGATCCGCACGAGAGCCGATCCCGCAACGACCGTCGTCGGGGTGCT
CGCGGCCTACCGGGATCTGCCCAACTCGGTATGGCGCGCGGTCTATCCGCTGCCGGCGGCGCCGGACGCC
GCCTGGTACCGCAACGCGCCCAAACTGAAACTGACCATCGATCTTGAAGCGAACGCAATCAGGATTACCG
AGATTAAATAG