SecReT6
Protein ID: 91783725
SecReT6 ID122
T6SS typei3
Gene symbol-
Locus tagBxe_A2089
StrainBurkholderia xenovorans LB400
Repliconchromosome I [GenBank: NC_007951] [Browse all T6SS(s) in this replicon]
Location [Strand]2619387..2620733 [+]
Producttemperature-dependent protein secretion, ImpJ
NoteTssK
UniProt IDQ13YG0
KEGG IDbxe:Bxe_A2089
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-142, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|91783725|ref|YP_558931.1| temperature-dependent protein secretion, ImpJ [Burkholderia xenovorans LB400]
MSWHNKVVWSEGLFLRPQLFQQQERYLEHYAHRRAATLSPFFFGFSHYSLDSEALALGKVIVKSASGVFA
DGTPFDTPGSTPPPAPLTIRAEHLDQLIYLAVPVRVPNAEETTFDNAADSLARNFVFDTELRDTNSIGQG
PKTVQLSNLRLRLVPEKELTDAWIGLALTRVKTIRADSSIVLDDTLIPPVAGFGASELLTSWLAKIHELT
RLRANSLAIRLTGANGNAGTTAEVSDYLLLQTLNRYEPLLQHLRRVPTTSPADLYALLLSMAGELSTYLR
TDSRRPLDSHPAYQHSTPHLCLKPLVDDTHVLLNAVLVRSAQSIELKELGHGMRNAVVDPVDMAGFTAVV
LAVHAAMPPDLLQQQFAAQAKAGPSERLPDLVRGHLPGITLQALPVPPRQIPFNAGFVYYELARSGPLWD
EVARHGGLALHVAGEFPSLKLELWGVRS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|91781384|ref|NC_007951.1|:2619387-2620733 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGAGCTGGCACAACAAAGTCGTCTGGAGCGAGGGGCTTTTTCTGCGCCCGCAGCTTTTCCAGCAGCAGG
AGCGGTACCTCGAACATTACGCGCACCGGCGCGCGGCCACCCTGTCGCCGTTTTTCTTCGGCTTCAGTCA
TTACAGCCTCGATAGCGAGGCACTGGCGCTCGGCAAGGTAATCGTGAAGTCGGCCAGCGGCGTGTTCGCG
GACGGCACGCCGTTCGATACGCCCGGCAGCACGCCGCCGCCCGCGCCGCTCACCATCCGCGCGGAACATC
TCGATCAACTGATCTATCTCGCCGTGCCTGTGCGCGTGCCGAACGCCGAAGAGACGACGTTCGACAACGC
CGCCGACTCGCTTGCCCGCAACTTCGTGTTCGACACCGAGCTGCGCGATACGAATTCGATCGGACAAGGC
CCGAAGACCGTGCAGTTGTCGAATCTGCGGCTGCGCCTCGTGCCCGAGAAGGAACTGACCGACGCATGGA
TCGGACTCGCGCTGACACGCGTGAAGACGATTCGCGCGGACAGCAGCATCGTTCTGGACGATACATTGAT
TCCGCCGGTGGCGGGCTTCGGCGCAAGCGAGCTGCTCACGAGCTGGCTCGCGAAGATTCACGAGCTCACG
CGCCTGCGTGCAAACTCGCTCGCAATCCGGCTGACCGGCGCCAACGGCAACGCCGGCACCACGGCGGAAG
TCTCCGACTATCTGCTGTTGCAAACGCTCAACCGTTACGAGCCGTTGCTTCAGCATCTGCGGCGGGTGCC
GACCACCTCGCCGGCGGATCTGTACGCGCTGCTGCTCAGCATGGCAGGAGAACTGTCGACCTACCTGCGC
ACCGACAGCCGGCGTCCGCTCGACTCCCATCCCGCCTATCAGCACAGCACGCCGCATCTCTGCCTGAAGC
CTCTGGTGGACGACACGCACGTGCTGCTCAATGCGGTGCTGGTGCGTAGCGCGCAGAGCATCGAACTGAA
GGAACTGGGACACGGCATGCGCAACGCCGTGGTCGATCCCGTCGACATGGCCGGCTTCACCGCGGTGGTG
CTCGCGGTGCACGCCGCGATGCCGCCCGACCTGCTCCAGCAACAGTTTGCCGCCCAGGCGAAAGCCGGTC
CTTCTGAACGGCTGCCGGATCTGGTGCGCGGACATCTGCCGGGCATCACGCTGCAGGCGTTGCCGGTGCC
GCCGCGACAGATCCCGTTCAACGCGGGCTTCGTCTATTACGAGCTCGCGCGAAGCGGTCCGTTGTGGGAC
GAGGTGGCGCGGCACGGCGGACTCGCCCTGCACGTGGCCGGCGAGTTCCCGTCGCTGAAGCTCGAACTGT
GGGGCGTGCGCAGCTAA