SecReT6
Protein ID: 91783726
SecReT6 ID122
T6SS typei3
Gene symbol-
Locus tagBxe_A2088
StrainBurkholderia xenovorans LB400
Repliconchromosome I [GenBank: NC_007951] [Browse all T6SS(s) in this replicon]
Location [Strand]2620821..2622152 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ13YF9
KEGG IDbxe:Bxe_A2088
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.20E-66, Aligned region: 70..279
OmpA [PF00691], Evalue: 7.50E-14, Aligned region: 337..435
Protein Sequence: 443 a.a.     [Download]
>gi|91783726|ref|YP_558932.1| hypothetical protein Bxe_A2088 [Burkholderia xenovorans LB400]
MNSEAANRSGERDPWSGDQGRIPAPVSRAAPDGASSRGAGAAPSDPPPHRDVPPGESAAERLAAIRAARN
PLLEAARPLLRALADLPVQLKRDEIEQLRMLLEQEVRMFQKLCDQISIRRDHMLGARYCLCTALDEAAMQ
TVWGKGGETGVEWNTNGLATLFHEDRQGGTKVYLLIGRLMSDSHEHLDLLELIYRILSLGFEGRYRYEAD
GRRKHETVRQRLYNEIMTRRGSLAVALSPHWQSHVKGRRVSFFDFPVWVTLAVLSVILIGLFGYFKYELL
NRSAEVRKQIADIGRMTPPVTRALHLKELLKNEIAAGTVSVDEDAHHSSVTFRGDSMFPPGAAAVKTSMT
PLITKIAGEIAKVPGKVTVLGYTDNVPIKSRQFASNAALSEERATQIMQMLQTAGVPAVRLEAVGRGDAD
PIGDNTTVQGRAQNRRVEITVAQ
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|91781384|ref|NC_007951.1|:2620821-2622152 Burkholderia xenovorans LB400 chromosome 1, complete sequence
GTGAATTCAGAAGCAGCGAACCGTTCAGGCGAGCGTGATCCGTGGTCCGGCGACCAGGGCCGCATACCGG
CTCCCGTCTCGCGTGCCGCGCCGGATGGAGCGTCTTCACGAGGCGCGGGCGCGGCGCCGTCTGACCCGCC
TCCTCATCGGGATGTACCGCCGGGTGAATCGGCTGCGGAGCGCCTTGCGGCCATCAGGGCGGCGCGCAAC
CCGCTGCTCGAAGCAGCTCGCCCATTGCTGCGAGCCCTGGCGGACCTGCCCGTGCAGTTGAAACGGGACG
AGATAGAACAGCTGCGCATGCTGCTGGAGCAGGAAGTGCGGATGTTCCAGAAACTCTGCGACCAGATCAG
CATCCGCCGCGATCATATGCTCGGCGCACGCTATTGTCTGTGTACGGCGCTCGACGAGGCCGCGATGCAA
ACGGTATGGGGCAAAGGCGGAGAGACCGGCGTCGAGTGGAATACCAACGGACTCGCCACGCTTTTCCACG
AAGACCGGCAAGGCGGCACCAAAGTCTATCTGCTGATCGGGCGGCTGATGAGCGATTCGCACGAACATCT
CGACCTGCTCGAACTCATTTACCGGATTCTTAGCCTGGGCTTCGAAGGCCGCTACCGCTACGAGGCCGAT
GGGCGACGCAAACATGAAACCGTGCGTCAGCGGCTCTACAACGAGATCATGACGCGGCGCGGGAGTCTCG
CCGTCGCGCTGTCGCCGCACTGGCAATCGCACGTAAAGGGCAGGCGCGTGTCGTTCTTCGACTTCCCGGT
ATGGGTCACGCTCGCCGTTCTGTCAGTCATCCTGATCGGTCTGTTCGGCTATTTCAAATACGAACTGCTG
AACCGGAGCGCGGAGGTGCGCAAACAGATCGCCGACATCGGGCGCATGACGCCGCCTGTCACGCGCGCAC
TGCATCTCAAGGAACTGTTGAAGAACGAGATCGCCGCGGGCACCGTGAGCGTCGACGAAGACGCGCATCA
CAGTTCGGTGACGTTCCGCGGAGATTCGATGTTCCCGCCGGGAGCGGCGGCGGTGAAGACCTCGATGACG
CCGTTGATCACGAAGATCGCGGGCGAAATTGCCAAGGTGCCGGGCAAGGTGACGGTGTTGGGATACACCG
ACAACGTGCCGATAAAAAGCCGTCAGTTCGCATCGAACGCAGCGCTCTCCGAAGAGCGCGCGACGCAGAT
CATGCAGATGCTTCAGACAGCGGGCGTGCCAGCGGTCCGGCTCGAAGCCGTGGGCAGGGGCGACGCCGAT
CCGATCGGGGATAACACGACCGTGCAGGGGCGCGCGCAGAATCGCCGCGTCGAAATCACGGTCGCGCAAT
AG