SecReT6
Protein ID: 92114375
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2254
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2531081..2533708 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ1QVA4
KEGG IDcsa:Csal_2254
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.80E-81, Aligned region: 41..353
Phage_GPD [PF05954], Evalue: 5.80E-81, Aligned region: 640..646
DUF2345 [PF10106], Evalue: 2.50E-55, Aligned region: 689..842
T6SS_Vgr [PF13296], Evalue: 4.20E-39, Aligned region: 348..382
T6SS_Vgr [PF13296], Evalue: 4.20E-39, Aligned region: 533..641
Phage_base_V [PF04717], Evalue: 4.40E-22, Aligned region: 430..523
Protein Sequence: 875 a.a.     [Download]
>gi|92114375|ref|YP_574303.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MEETMQDRLLDSFDIDLSQSQRLLTLEVAGTALLPHRLVGEERVSAPFTYTLDCISQQNDLELKTLLAQP
ARLSILQADGSYRPLHGLVSEAALLGEDGGVTYYQLTLVPWLKMLALGRDSRIFQDRSVVDVLTQVFEGH
ALARGRYRFDLRRDYPARSYCVQYRESDLNFISRLCEEEGLFYYTEFAGDDDDFDGHRIVFTDDVDTTQP
VSPQAIRFHRQDATETEDALNQWGGVRQQQPTRVSVGTFDYKQPSLTKRTGLDTLSDQGNLPPTEVYDYA
GEYYYHGFERGERLTENRLEAHESLAKRFRGSGGARQLQAGRWFELTQHPLHDRGGEEERQFLLLGVTVH
AENALPVSTQHQALPGSLQPQLDAAKQAHGLESDTADPTGERLSDYATGGTGHFLVDLEAQRRSQPYRHP
LTHRRPVIGGPQTATVVGPANEEIHTDALNRVRVQFHWDRQGQHDENSSVWLRVSQPNAGAGWGGVFVPR
IGQEVLVDFLEGDADRPLITGRVYNGEQSPDWHSHGLLSGFKSKTYRGSKYNELVFDDATDQERVRLSSE
AEKSQLNLGYLIHQTGNTRGAFRGTGFELRSDAYGAIRANQGLYLTSWGQLGASGDQLDLTPAKQQLDSA
YNLTDSLSQSAADHNAEALDSRTHLKQAGEDADDTYGTSEQLVDSQGQANQDSARGATDSGGRGEAARMK
APWLHLASPAGITLSTPESTHLAQGRSLSVSSGEDVNVATGKSLVASISERLSLFVQKAGIKLFSARGKV
EMQAQSDNLEATARRDLGVTSTEDKIDFAAAEEILLVSGGAYVRIKGGDIELHAPGKVTVKGATKNFGGP
ASLNSQMPYLPEEASPLCPKKNRAAASVGEGSVEI
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|92112136|ref|NC_007963.1|:c2533708-2531081 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
ATGGAAGAGACGATGCAGGATCGTTTACTGGATAGCTTCGATATCGATCTTTCGCAGTCGCAGCGGTTGC
TGACCCTCGAGGTCGCCGGGACGGCGCTGCTGCCGCATCGCCTGGTGGGGGAGGAGCGCGTGAGTGCCCC
CTTCACCTACACCCTCGACTGTATCTCCCAGCAGAACGATCTCGAGCTCAAGACATTGCTGGCCCAGCCG
GCCCGGCTTTCGATCCTGCAGGCCGACGGCAGCTATCGCCCGCTGCACGGGCTGGTCTCCGAGGCCGCGC
TGCTGGGCGAGGATGGCGGCGTCACCTATTACCAGCTCACCCTGGTGCCGTGGCTCAAGATGCTCGCGCT
GGGCCGCGACAGCCGCATCTTCCAGGACCGCAGCGTCGTTGATGTCCTCACCCAGGTATTCGAGGGGCAT
GCACTGGCCAGGGGCCGCTACCGCTTCGACCTGCGCCGCGACTACCCCGCGCGCAGCTACTGCGTGCAGT
ACCGCGAGAGCGACCTGAACTTCATCAGCCGCCTCTGCGAGGAAGAAGGCCTCTTCTACTACACCGAATT
CGCGGGCGATGACGATGACTTCGACGGCCACCGCATCGTCTTTACCGACGATGTCGATACCACCCAGCCC
GTCAGCCCCCAGGCGATTCGCTTTCATCGTCAGGATGCCACCGAGACCGAGGACGCCCTCAACCAGTGGG
GCGGCGTGCGTCAGCAGCAGCCCACCCGGGTCAGCGTGGGCACCTTCGACTACAAGCAGCCCTCGCTCAC
CAAGCGCACCGGACTGGATACTCTCAGCGATCAGGGCAACCTGCCGCCGACCGAGGTCTACGACTACGCC
GGCGAGTACTACTACCACGGCTTCGAGCGCGGCGAGCGCCTCACCGAGAACCGCCTCGAGGCCCATGAAT
CGCTGGCCAAGCGCTTTCGCGGCAGCGGCGGTGCCCGCCAGCTCCAGGCCGGGCGCTGGTTCGAACTCAC
CCAGCACCCGCTGCACGACCGGGGCGGCGAGGAAGAACGCCAGTTCCTGCTGCTCGGCGTCACCGTCCAC
GCCGAGAACGCGCTGCCGGTCTCGACCCAGCACCAGGCGCTGCCCGGCAGCCTGCAGCCGCAGCTCGACG
CCGCCAAGCAGGCGCATGGGCTGGAGAGTGATACCGCTGATCCCACCGGCGAGCGGCTATCGGATTACGC
CACCGGCGGCACCGGCCACTTCCTGGTCGATCTCGAGGCCCAGCGGCGCAGCCAGCCCTATCGCCACCCG
CTGACCCATCGCCGCCCGGTGATCGGCGGGCCCCAGACCGCCACCGTGGTCGGCCCCGCCAACGAGGAGA
TCCACACCGATGCCCTCAACCGCGTGCGGGTGCAGTTCCACTGGGACCGCCAGGGCCAGCATGACGAGAA
CTCCAGCGTCTGGCTGCGGGTCTCCCAGCCCAACGCCGGTGCCGGCTGGGGCGGCGTGTTCGTGCCGCGC
ATCGGCCAGGAAGTCCTCGTCGACTTCCTCGAGGGCGACGCCGACCGGCCGCTGATCACCGGCCGGGTCT
ACAACGGCGAACAGAGCCCCGACTGGCACAGCCACGGCCTGCTCTCGGGCTTCAAGAGCAAGACCTATCG
CGGCAGCAAGTACAACGAACTCGTCTTCGACGACGCCACCGACCAGGAGCGCGTTCGTCTCAGTTCCGAA
GCCGAGAAGAGCCAGCTCAACCTCGGCTACCTGATCCACCAGACCGGCAACACCCGGGGCGCCTTCCGCG
GCACCGGGTTCGAGCTGCGCAGCGACGCCTATGGCGCTATCCGTGCCAACCAGGGGCTCTATCTCACCAG
CTGGGGCCAGCTCGGCGCCAGCGGTGACCAGCTCGACCTCACCCCGGCCAAGCAGCAGCTCGACAGCGCC
TATAACCTCACCGACAGCCTCAGCCAGAGTGCGGCGGACCACAACGCCGAGGCCCTCGACAGTCGTACAC
ACCTCAAGCAGGCGGGCGAGGACGCCGACGACACCTACGGCACCAGCGAGCAGCTCGTCGATTCACAAGG
TCAGGCCAATCAGGACAGCGCCCGTGGCGCCACCGACAGCGGCGGCCGCGGTGAAGCGGCGCGCATGAAA
GCCCCCTGGCTGCACCTGGCCTCGCCCGCCGGCATCACGCTGAGCACCCCGGAGTCGACCCATCTGGCCC
AGGGCCGCTCGCTGAGTGTTTCCAGCGGCGAGGACGTCAACGTGGCTACCGGCAAGAGTCTGGTCGCCTC
CATTTCCGAGAGGCTCTCGCTGTTCGTGCAGAAGGCTGGCATCAAGCTGTTCTCGGCTCGGGGCAAGGTG
GAGATGCAGGCGCAGTCGGACAACCTGGAAGCCACCGCGCGGCGGGATCTCGGCGTGACCTCCACGGAAG
ACAAGATCGACTTCGCCGCCGCCGAAGAGATTTTGCTGGTCAGCGGCGGCGCCTACGTGCGCATCAAGGG
CGGCGATATCGAGCTGCACGCCCCCGGCAAGGTCACCGTCAAGGGCGCGACGAAGAACTTCGGCGGGCCG
GCGAGCCTGAACTCGCAGATGCCTTATTTGCCGGAGGAGGCGAGCCCTCTTTGTCCCAAGAAGAACCGAG
CTGCAGCCAGCGTGGGCGAGGGAAGCGTGGAGATATGA