SecReT6
Protein ID: 92114375
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2254
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2531081..2533708 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ1QVA4
KEGG IDcsa:Csal_2254
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.80E-81, Aligned region: 41..353
Phage_GPD [PF05954], Evalue: 5.80E-81, Aligned region: 640..646
DUF2345 [PF10106], Evalue: 2.50E-55, Aligned region: 689..842
T6SS_Vgr [PF13296], Evalue: 4.20E-39, Aligned region: 348..382
T6SS_Vgr [PF13296], Evalue: 4.20E-39, Aligned region: 533..641
Phage_base_V [PF04717], Evalue: 4.40E-22, Aligned region: 430..523
Protein Sequence: 875 a.a.     [Download]
>gi|92114375|ref|YP_574303.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MEETMQDRLLDSFDIDLSQSQRLLTLEVAGTALLPHRLVGEERVSAPFTYTLDCISQQNDLELKTLLAQP
ARLSILQADGSYRPLHGLVSEAALLGEDGGVTYYQLTLVPWLKMLALGRDSRIFQDRSVVDVLTQVFEGH
ALARGRYRFDLRRDYPARSYCVQYRESDLNFISRLCEEEGLFYYTEFAGDDDDFDGHRIVFTDDVDTTQP
VSPQAIRFHRQDATETEDALNQWGGVRQQQPTRVSVGTFDYKQPSLTKRTGLDTLSDQGNLPPTEVYDYA
GEYYYHGFERGERLTENRLEAHESLAKRFRGSGGARQLQAGRWFELTQHPLHDRGGEEERQFLLLGVTVH
AENALPVSTQHQALPGSLQPQLDAAKQAHGLESDTADPTGERLSDYATGGTGHFLVDLEAQRRSQPYRHP
LTHRRPVIGGPQTATVVGPANEEIHTDALNRVRVQFHWDRQGQHDENSSVWLRVSQPNAGAGWGGVFVPR
IGQEVLVDFLEGDADRPLITGRVYNGEQSPDWHSHGLLSGFKSKTYRGSKYNELVFDDATDQERVRLSSE
AEKSQLNLGYLIHQTGNTRGAFRGTGFELRSDAYGAIRANQGLYLTSWGQLGASGDQLDLTPAKQQLDSA
YNLTDSLSQSAADHNAEALDSRTHLKQAGEDADDTYGTSEQLVDSQGQANQDSARGATDSGGRGEAARMK
APWLHLASPAGITLSTPESTHLAQGRSLSVSSGEDVNVATGKSLVASISERLSLFVQKAGIKLFSARGKV
EMQAQSDNLEATARRDLGVTSTEDKIDFAAAEEILLVSGGAYVRIKGGDIELHAPGKVTVKGATKNFGGP
ASLNSQMPYLPEEASPLCPKKNRAAASVGEGSVEI
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|92112136|ref|NC_007963.1|:c2533708-2531081 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
ATGGAAGAGACGATGCAGGATCGTTTACTGGATAGCTTCGATATCGATCTTTCGCAGTCGCAGCGGTTGC
TGACCCTCGAGGTCGCCGGGACGGCGCTGCTGCCGCATCGCCTGGTGGGGGAGGAGCGCGTGAGTGCCCC
CTTCACCTACACCCTCGACTGTATCTCCCAGCAGAACGATCTCGAGCTCAAGACATTGCTGGCCCAGCCG
GCCCGGCTTTCGATCCTGCAGGCCGACGGCAGCTATCGCCCGCTGCACGGGCTGGTCTCCGAGGCCGCGC
TGCTGGGCGAGGATGGCGGCGTCACCTATTACCAGCTCACCCTGGTGCCGTGGCTCAAGATGCTCGCGCT
GGGCCGCGACAGCCGCATCTTCCAGGACCGCAGCGTCGTTGATGTCCTCACCCAGGTATTCGAGGGGCAT
GCACTGGCCAGGGGCCGCTACCGCTTCGACCTGCGCCGCGACTACCCCGCGCGCAGCTACTGCGTGCAGT
ACCGCGAGAGCGACCTGAACTTCATCAGCCGCCTCTGCGAGGAAGAAGGCCTCTTCTACTACACCGAATT
CGCGGGCGATGACGATGACTTCGACGGCCACCGCATCGTCTTTACCGACGATGTCGATACCACCCAGCCC
GTCAGCCCCCAGGCGATTCGCTTTCATCGTCAGGATGCCACCGAGACCGAGGACGCCCTCAACCAGTGGG
GCGGCGTGCGTCAGCAGCAGCCCACCCGGGTCAGCGTGGGCACCTTCGACTACAAGCAGCCCTCGCTCAC
CAAGCGCACCGGACTGGATACTCTCAGCGATCAGGGCAACCTGCCGCCGACCGAGGTCTACGACTACGCC
GGCGAGTACTACTACCACGGCTTCGAGCGCGGCGAGCGCCTCACCGAGAACCGCCTCGAGGCCCATGAAT
CGCTGGCCAAGCGCTTTCGCGGCAGCGGCGGTGCCCGCCAGCTCCAGGCCGGGCGCTGGTTCGAACTCAC
CCAGCACCCGCTGCACGACCGGGGCGGCGAGGAAGAACGCCAGTTCCTGCTGCTCGGCGTCACCGTCCAC
GCCGAGAACGCGCTGCCGGTCTCGACCCAGCACCAGGCGCTGCCCGGCAGCCTGCAGCCGCAGCTCGACG
CCGCCAAGCAGGCGCATGGGCTGGAGAGTGATACCGCTGATCCCACCGGCGAGCGGCTATCGGATTACGC
CACCGGCGGCACCGGCCACTTCCTGGTCGATCTCGAGGCCCAGCGGCGCAGCCAGCCCTATCGCCACCCG
CTGACCCATCGCCGCCCGGTGATCGGCGGGCCCCAGACCGCCACCGTGGTCGGCCCCGCCAACGAGGAGA
TCCACACCGATGCCCTCAACCGCGTGCGGGTGCAGTTCCACTGGGACCGCCAGGGCCAGCATGACGAGAA
CTCCAGCGTCTGGCTGCGGGTCTCCCAGCCCAACGCCGGTGCCGGCTGGGGCGGCGTGTTCGTGCCGCGC
ATCGGCCAGGAAGTCCTCGTCGACTTCCTCGAGGGCGACGCCGACCGGCCGCTGATCACCGGCCGGGTCT
ACAACGGCGAACAGAGCCCCGACTGGCACAGCCACGGCCTGCTCTCGGGCTTCAAGAGCAAGACCTATCG
CGGCAGCAAGTACAACGAACTCGTCTTCGACGACGCCACCGACCAGGAGCGCGTTCGTCTCAGTTCCGAA
GCCGAGAAGAGCCAGCTCAACCTCGGCTACCTGATCCACCAGACCGGCAACACCCGGGGCGCCTTCCGCG
GCACCGGGTTCGAGCTGCGCAGCGACGCCTATGGCGCTATCCGTGCCAACCAGGGGCTCTATCTCACCAG
CTGGGGCCAGCTCGGCGCCAGCGGTGACCAGCTCGACCTCACCCCGGCCAAGCAGCAGCTCGACAGCGCC
TATAACCTCACCGACAGCCTCAGCCAGAGTGCGGCGGACCACAACGCCGAGGCCCTCGACAGTCGTACAC
ACCTCAAGCAGGCGGGCGAGGACGCCGACGACACCTACGGCACCAGCGAGCAGCTCGTCGATTCACAAGG
TCAGGCCAATCAGGACAGCGCCCGTGGCGCCACCGACAGCGGCGGCCGCGGTGAAGCGGCGCGCATGAAA
GCCCCCTGGCTGCACCTGGCCTCGCCCGCCGGCATCACGCTGAGCACCCCGGAGTCGACCCATCTGGCCC
AGGGCCGCTCGCTGAGTGTTTCCAGCGGCGAGGACGTCAACGTGGCTACCGGCAAGAGTCTGGTCGCCTC
CATTTCCGAGAGGCTCTCGCTGTTCGTGCAGAAGGCTGGCATCAAGCTGTTCTCGGCTCGGGGCAAGGTG
GAGATGCAGGCGCAGTCGGACAACCTGGAAGCCACCGCGCGGCGGGATCTCGGCGTGACCTCCACGGAAG
ACAAGATCGACTTCGCCGCCGCCGAAGAGATTTTGCTGGTCAGCGGCGGCGCCTACGTGCGCATCAAGGG
CGGCGATATCGAGCTGCACGCCCCCGGCAAGGTCACCGTCAAGGGCGCGACGAAGAACTTCGGCGGGCCG
GCGAGCCTGAACTCGCAGATGCCTTATTTGCCGGAGGAGGCGAGCCCTCTTTGTCCCAAGAAGAACCGAG
CTGCAGCCAGCGTGGGCGAGGGAAGCGTGGAGATATGA

Protein ID: 92114395
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2274
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2557718..2560333 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ1QV84
KEGG IDcsa:Csal_2274
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-80, Aligned region: 44..354
Phage_GPD [PF05954], Evalue: 2.00E-80, Aligned region: 623..684
DUF2345 [PF10106], Evalue: 8.20E-60, Aligned region: 686..839
T6SS_Vgr [PF13296], Evalue: 9.30E-39, Aligned region: 349..383
T6SS_Vgr [PF13296], Evalue: 9.30E-39, Aligned region: 534..642
Phage_base_V [PF04717], Evalue: 7.60E-23, Aligned region: 431..524
Sarcoglycan_1 [PF04790], Evalue: 1.00E-06, Aligned region: 734..804
Protein Sequence: 871 a.a.     [Download]
>gi|92114395|ref|YP_574323.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MADLAMLDSLLDSFDIDLSQSQRLLTLEVAGTALLPHRLVGEDRVSAPFTYTLDCISQQNDLELKTLLAQ
PARLSILQADGSYRPLHGLVSEAALLGEDGGVTYYQLTLVPWLKMLALGRDSRIFQDRSVVDVLTQVFEG
HALARGRYRFDLRRDYPARSYCVQYRESDLNFISRLCEEEGLFYYTEFAGDDDDFDGHRIVFTDDVDTTQ
PVSPQAIRFHRQDATETEDALNQWGGVRQQQPTRVSVGTFDYKQPSLTKRTGLDTLSDQGNLPPTEVYDY
AGEYYYHGFERGERLTENRLEAHESLAKRFRGSGGARQLQAGRWFELTQHPLHDRGGEEERQFLLLGVTV
HAENALPVSTQHQALPGSLQPQLDAAKQAHGLESDTADPTGERLSDYATGGTGHFLVDLEAQRRSQPYRH
PLTHRRPVIGGPQTATVVGPANEEIHTDALNRVRVQFHWDRQGQHDENSSVWLRVSQPNAGAGWGGVFVP
RIGQEVLVDFLEGDADRPLITGRVYNGEQPPDWHSHGLLSGFKSKTYRGSKYNELVFDDATDQERVRLSS
EAEKSQLNLGYLIHQTGNTRGAFRGTGFELRSDAYGAIRANQGLYLTSWGQLGASGDQLDLTPAKQQLDS
AYQLSDTLSQSAQDHNAEALDSRTHLKQAGEDADDTYGNSEQLADAQQDSARGATDSGGRGEAARMKAPW
LHLASPAGITLSTPESTHLAQGRSLSVSSGEDVNVATGKSLVASISEKLSLFVQKAGIKLFAARGKVEMQ
AQSDAMELTAEKDVKITSTEGRVEINAANGILLNSGGGYIRIEGGNIDVHGPGKIDVKGAQHVFGGPTSL
DAAMPELPEGECEKQFAGADKSSSGTTPVGG
 
Nucleotide Sequence: 2616 bp     [Download]
>gi|92112136|ref|NC_007963.1|:2557718-2560333 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
ATGGCAGATTTAGCAATGCTGGACAGTTTACTGGATAGCTTCGATATCGATCTTTCGCAGTCGCAGCGGT
TGCTGACCCTCGAGGTCGCCGGGACGGCGCTGCTGCCGCATCGCCTGGTGGGCGAGGACCGCGTGAGCGC
CCCCTTCACCTACACCCTCGACTGCATCTCCCAGCAGAACGATCTCGAGCTCAAGACATTGCTGGCCCAG
CCGGCCCGGCTTTCGATCCTGCAGGCCGACGGCAGCTATCGCCCGCTGCACGGGCTGGTCTCCGAGGCCG
CGCTGCTGGGCGAGGATGGCGGCGTCACCTATTACCAGCTCACCCTGGTGCCGTGGCTCAAGATGCTCGC
GCTGGGCCGCGACAGCCGCATCTTCCAGGACCGCAGCGTCGTTGATGTCCTCACCCAGGTATTCGAGGGG
CATGCACTGGCCAGGGGCCGCTACCGCTTCGACCTGCGCCGCGACTACCCCGCGCGCAGCTACTGCGTGC
AGTACCGCGAGAGCGACCTGAACTTCATCAGCCGCCTCTGCGAGGAAGAAGGCCTCTTCTACTACACCGA
ATTCGCGGGCGATGACGATGACTTCGACGGCCACCGCATCGTCTTTACCGACGATGTCGATACCACCCAG
CCCGTCAGCCCCCAGGCGATTCGCTTTCATCGTCAGGATGCCACCGAGACCGAGGACGCCCTCAACCAGT
GGGGCGGCGTGCGTCAGCAGCAGCCCACCCGGGTCAGCGTGGGCACCTTCGACTACAAGCAGCCCTCGCT
CACCAAGCGCACCGGACTGGATACTCTCAGCGATCAGGGCAACCTGCCGCCGACCGAGGTCTACGACTAC
GCCGGCGAGTACTACTACCACGGCTTCGAGCGCGGCGAGCGCCTCACCGAGAACCGCCTCGAGGCCCATG
AATCGCTGGCCAAGCGCTTTCGCGGCAGCGGCGGTGCCCGCCAGCTCCAGGCCGGGCGCTGGTTCGAACT
CACCCAGCACCCGCTGCACGACCGGGGCGGCGAGGAAGAACGCCAGTTCCTGCTGCTCGGCGTCACCGTC
CACGCCGAGAACGCGCTGCCGGTCTCGACCCAGCACCAGGCGCTGCCCGGCAGCCTGCAGCCGCAGCTCG
ACGCCGCCAAGCAGGCGCATGGGCTGGAGAGTGATACCGCTGATCCCACCGGCGAGCGGCTATCGGATTA
CGCCACCGGCGGCACCGGCCACTTCCTGGTCGATCTCGAGGCCCAGCGGCGCAGCCAGCCCTATCGCCAC
CCGCTGACCCATCGCCGCCCGGTGATCGGCGGGCCCCAGACCGCCACCGTGGTCGGCCCCGCCAACGAGG
AGATCCACACCGATGCCCTCAACCGCGTGCGGGTGCAGTTCCACTGGGACCGCCAGGGCCAGCATGACGA
GAACTCCAGCGTCTGGCTGCGGGTCTCCCAGCCCAACGCCGGTGCCGGCTGGGGCGGCGTGTTCGTGCCG
CGCATCGGCCAGGAAGTCCTCGTCGACTTCCTCGAGGGCGACGCCGACCGGCCGCTGATCACCGGCCGGG
TCTACAACGGCGAGCAGCCCCCCGACTGGCACAGCCATGGCCTGCTCTCGGGCTTCAAGAGCAAGACCTA
TCGCGGCAGCAAGTACAACGAACTCGTCTTCGACGACGCCACCGACCAGGAGCGTGTGCGTCTCAGTTCC
GAAGCCGAGAAGAGCCAGCTCAACCTCGGCTACCTGATCCACCAGACCGGCAACACCCGGGGCGCCTTCC
GCGGCACCGGGTTCGAGCTGCGCAGCGACGCCTATGGCGCCATCCGCGCCAACCAGGGGCTCTACCTCAC
CAGCTGGGGCCAGCTCGGCGCCAGCGGTGACCAGCTCGACCTCACCCCGGCCAAGCAGCAGCTCGACAGC
GCTTACCAGCTCAGCGACACGCTGAGTCAAAGCGCCCAGGATCATAACGCCGAGGCCCTCGACAGTCGTA
CACACCTCAAGCAGGCGGGCGAGGACGCCGACGACACCTACGGCAACAGCGAGCAGCTCGCGGATGCCCA
GCAGGACAGCGCCCGTGGTGCCACCGACAGCGGCGGCCGCGGTGAAGCGGCGCGCATGAAAGCCCCCTGG
CTACACCTGGCCTCGCCCGCCGGCATCACGCTGAGCACCCCGGAGTCGACTCACTTGGCCCAGGGCCGCT
CGCTGAGTGTTTCCAGCGGCGAGGACGTCAACGTGGCCACCGGCAAGAGCCTGGTCGCCTCCATTTCCGA
GAAGCTCTCGCTGTTCGTGCAGAAGGCTGGCATCAAGCTATTCGCGGCACGGGGTAAGGTGGAGATGCAG
GCGCAGAGTGACGCGATGGAGTTGACCGCCGAGAAGGACGTCAAGATCACCTCCACCGAGGGGCGGGTCG
AGATCAACGCCGCCAACGGCATTCTACTGAACAGTGGTGGCGGCTATATCCGCATCGAAGGCGGCAACAT
CGACGTCCACGGCCCCGGCAAGATCGACGTCAAGGGCGCACAGCATGTCTTCGGCGGACCGACGAGCCTC
GACGCGGCCATGCCCGAATTGCCGGAGGGAGAGTGCGAAAAGCAGTTCGCGGGCGCCGATAAATCGTCTT
CAGGCACCACGCCCGTGGGAGGCTGA