SecReT6
Protein ID: 92114376
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2255
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2533831..2534100 [+]
Producthypothetical protein
NotePAAR
UniProt IDQ1QVA3
KEGG IDcsa:Csal_2255
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.20E-28, Aligned region: 7..81
Protein Sequence: 89 a.a.     [Download]
>gi|92114376|ref|YP_574304.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MKGIVVLGDATSHGGKVITAQSSYLIDGKPVACVGDKVTCPKDGHGGTTVIVEGHPTMKVNGKPIALHGH
KTACGATLISSHNGDSGHE
 
Nucleotide Sequence: 270 bp     [Download]
>gi|92112136|ref|NC_007963.1|:2533831-2534100 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
ATGAAAGGCATCGTTGTACTTGGTGACGCCACGAGCCATGGCGGAAAAGTCATTACCGCGCAGAGCAGCT
ATCTGATCGACGGCAAGCCCGTCGCTTGCGTCGGGGACAAAGTCACATGTCCCAAGGACGGTCATGGCGG
TACCACGGTCATCGTCGAGGGCCACCCGACCATGAAGGTCAATGGCAAGCCGATCGCCCTGCATGGACAC
AAGACCGCCTGTGGCGCGACCCTGATCTCCTCGCACAATGGCGACAGCGGTCACGAGTGA