SecReT6
Protein ID: 92114378
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2257
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2535248..2536363 [-]
ProductImpA-like protein
NoteTssA
UniProt IDQ1QVA1
KEGG IDcsa:Csal_2257
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.70E-22, Aligned region: 60..121
ImpA-rel_N [PF06812], Evalue: 4.70E-22, Aligned region: 245..250
Protein Sequence: 371 a.a.     [Download]
>gi|92114378|ref|YP_574306.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MEQLGELSIDALLAPVEGGSHAGGEDLSFSLLFDDIKEARRADPAYLPQGEWQTELKQSDWGQVINLSSE
ALISRSKDLQLAGWLCEGLAYRQGFEGIAFGLTLVARMLDEYWQTLYPELDEDDLEERSARLSWLGDTLI
GVVRTLPLLDGEGYGLADYDESRQVENQARNDPDAMDRALSDGKINDEIFQRSVVLTSTEFLQQKHAVIA
AILAALEQLERTVDARFDRDAPSFSGLQKVLVQCRELTERLLRERGANVSADTDAQAPEEVKAEAPDSSR
IEPSLTTPVAEPAGALRTKPQSRDEAFEMLNGVARYFKDREPHSPVPYLIERAVKWGRMPLEEWLKDVIK
DHGVIDNIRDTLGTQPKDDDY
 
Nucleotide Sequence: 1116 bp     [Download]
>gi|92112136|ref|NC_007963.1|:c2536363-2535248 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
ATGGAGCAACTCGGCGAACTCTCCATCGATGCGCTGCTGGCGCCCGTCGAGGGCGGTAGCCATGCCGGCG
GGGAGGATCTGTCCTTCTCGCTTCTCTTCGATGACATCAAGGAGGCACGTCGTGCCGATCCTGCATACTT
GCCGCAAGGCGAGTGGCAAACGGAGCTAAAGCAGTCCGACTGGGGGCAAGTGATCAACCTGTCCAGCGAG
GCGCTGATCTCCCGGAGCAAGGATCTCCAGCTCGCCGGCTGGTTGTGCGAGGGGCTGGCATACCGCCAAG
GCTTCGAGGGTATCGCCTTCGGCCTGACGCTGGTGGCCAGAATGCTGGACGAATATTGGCAGACCCTCTA
CCCCGAGCTTGACGAGGACGACCTCGAGGAACGCTCGGCGCGTCTGAGCTGGCTGGGCGATACGCTGATC
GGCGTGGTCAGGACGCTGCCGCTGCTCGATGGTGAGGGGTACGGACTGGCTGACTACGACGAGTCCCGCC
AGGTCGAGAACCAGGCCCGCAATGATCCGGATGCCATGGATCGGGCCTTGAGCGATGGCAAGATCAATGA
CGAGATCTTCCAGCGCTCGGTCGTGCTCACCAGTACCGAGTTTCTGCAGCAGAAGCATGCCGTCATCGCC
GCGATCCTGGCCGCATTGGAGCAGTTGGAGCGCACCGTGGATGCGCGGTTCGACCGTGATGCGCCGAGTT
TTTCCGGATTGCAGAAGGTGCTGGTGCAGTGTCGCGAGCTGACCGAAAGGCTGTTGCGCGAGCGCGGTGC
CAATGTCTCCGCCGATACCGACGCACAGGCCCCGGAAGAGGTGAAGGCCGAAGCGCCGGACTCGAGCCGG
ATCGAGCCGAGCCTGACCACCCCCGTGGCAGAGCCGGCGGGGGCGTTGCGTACCAAGCCGCAAAGCCGCG
ACGAAGCTTTCGAAATGCTCAACGGGGTCGCCCGCTACTTCAAGGATCGCGAACCTCACAGTCCGGTGCC
GTACTTGATCGAACGCGCCGTGAAGTGGGGCCGCATGCCGCTGGAAGAGTGGCTCAAGGATGTCATCAAG
GACCATGGTGTCATCGACAACATTCGCGACACCCTGGGCACGCAGCCGAAGGATGACGATTACTGA