SecReT6
Protein ID: 92114379
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2258
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2536669..2537199 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ1QVA0
KEGG IDcsa:Csal_2258
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-44, Aligned region: 6..150
Protein Sequence: 176 a.a.     [Download]
>gi|92114379|ref|YP_574307.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MAFDAYLKIDGIPGESLDDKHPDWIELKSFDFGASQATSATASSSGGASAERVNLSEFRIQKFVDKASAK
LFESCCKGQHIKEVVLHVNRAGGDKVRYMEIKLEEVIVSSTEMEGTSTATGFEQGENEDRHDLPFETVKF
NYARIKITYTQQKRSDGQGGGNVAGGWDRTRNKVYS
 
Nucleotide Sequence: 531 bp     [Download]
>gi|92112136|ref|NC_007963.1|:c2537199-2536669 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
ATGGCTTTTGATGCGTACTTGAAAATCGATGGTATTCCCGGCGAGAGCCTGGATGACAAGCATCCGGACT
GGATCGAGCTGAAGAGCTTTGATTTCGGGGCCAGCCAGGCAACGTCCGCTACCGCCAGTTCGTCCGGTGG
TGCTTCCGCAGAACGCGTGAACCTGAGCGAGTTTCGTATCCAGAAATTCGTCGACAAGGCCTCCGCCAAA
TTGTTCGAGTCCTGCTGTAAAGGTCAGCACATCAAGGAAGTGGTGCTGCATGTCAACCGCGCCGGTGGCG
ACAAGGTGCGTTACATGGAAATCAAGCTGGAGGAAGTGATCGTGTCTTCCACCGAGATGGAAGGGACCTC
GACGGCCACTGGCTTCGAACAGGGCGAAAACGAAGATCGCCATGATCTGCCCTTCGAGACGGTCAAGTTC
AACTACGCGCGGATCAAGATCACCTACACCCAGCAGAAGCGCTCCGACGGTCAGGGCGGCGGCAATGTTG
CCGGTGGCTGGGACCGCACCCGCAACAAGGTTTATTCCTAA