SecReT6
Protein ID: 92114381
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2260
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2537550..2540042 [-]
ProductOmpA/MotB protein
NoteTssM
UniProt IDQ1QV98
KEGG IDcsa:Csal_2260
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.30E-74, Aligned region: 192..457
OmpA [PF00691], Evalue: 5.10E-18, Aligned region: 717..810
IcmF-related [PF06761], Evalue: 3.60E-13, Aligned region: 502..696
IcmF-related [PF06761], Evalue: 3.60E-13, Aligned region: 722..744
MMR_HSR1 [PF01926], Evalue: 0.00076, Aligned region: 72..99
MMR_HSR1 [PF01926], Evalue: 0.00076, Aligned region: 134..266
Protein Sequence: 830 a.a.     [Download]
>gi|92114381|ref|YP_574309.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MKRFKFAYIKYAFFKYQPYILGLLFFATIFVVWWLGVALGFSSLASLLCGIVLFLLASAFYVLLLYRGVG
QKRNLEHLLREDADAAVLDASPQDREEISLLRERLLKTIERLKKSGKSKGKRGNDALYALPWYMIVGQPA
AGKSTMVYESGLNFPFAERENARVAGMGGTRHCDWFFSSDAILLDTAGRYMNSEEEAGKWKGFLSLLKEH
RRHCPLNGLIVAVNISDVVQASDTQRNNLARRLRERIQEARDHLEARLPIYLVFTKCDLIEGFTTFFEHL
DPQRQSDVLGHTFPHQQPSDVNWGVQFDAALNELCRHWLQVGDDEIVQRDVVETRRDVAAFRFPLELAAL
RDPLTRFVDALTNANPYQSAPLLRGFYFVSALQEGDAIEGEHASRVGRHFALAKPERLAGERVNHAFFIS
NLFRQVIIADQHLAGLYSSDVRGRRRKLRWTLAAAALGAIACTLWITSAVRNHGEIEAMSHTFAEAAAED
DDRQAHYARWHSLDALRDWGSHYYQRHQNGGVPWSMGWGLYQGDEIEPAIRKTYFDRLQSVMLEPVEQNL
TRSLFTLTTIGVYRRTADELHAVDGPDTVAPYARPRDNSAESLAKFGRNTLDTYLMLSDMERADIDSDVL
RNRLPAFWYPAIQRRTGAEIDEGRADYRYAGRQVDFYSQQIHASDVPRITSNAFLVSSSRNYIDSLLEQT
LTSTETIVLESDTLFAFGRGDYAGLQQAGQQELDKLAERLLNTQDLGQILITGHADPIGNEAANQQLSLQ
RAMTVRQYLIGKGVPAGLIEAKGAGSERPLVTCDDDQPRAQLIECLAPNRRVEIEVRKQQ
 
Nucleotide Sequence: 2493 bp     [Download]
>gi|92112136|ref|NC_007963.1|:c2540042-2537550 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
ATGAAACGTTTCAAATTCGCTTATATAAAGTACGCGTTCTTCAAGTACCAGCCATATATTCTGGGGCTGC
TCTTCTTCGCGACCATCTTCGTGGTGTGGTGGCTGGGAGTGGCGCTGGGCTTTTCGTCGCTGGCCAGCCT
GCTATGCGGAATCGTGCTCTTTCTGTTGGCCTCGGCGTTCTATGTGTTGCTGCTCTATCGTGGCGTGGGG
CAGAAACGCAATCTCGAGCATCTGCTCCGGGAGGACGCCGACGCGGCGGTACTCGATGCCAGCCCGCAGG
ATCGTGAAGAGATCAGTCTGCTGCGCGAACGCCTGCTGAAGACCATCGAGCGTCTCAAGAAGAGCGGCAA
GAGCAAGGGCAAGCGGGGCAACGACGCGCTTTACGCGCTGCCCTGGTACATGATCGTGGGGCAGCCCGCG
GCCGGCAAGAGCACCATGGTCTACGAGTCGGGGCTCAACTTTCCCTTCGCCGAGCGCGAGAACGCCCGCG
TGGCCGGTATGGGCGGGACGCGTCACTGCGACTGGTTCTTCAGCTCCGATGCCATTCTGCTGGATACCGC
CGGGCGTTACATGAACAGCGAAGAGGAGGCCGGGAAATGGAAGGGCTTCCTGTCGCTGCTCAAGGAACAT
CGTCGCCACTGTCCGCTCAATGGCCTGATCGTCGCGGTCAACATCAGCGACGTGGTGCAGGCCAGCGATA
CCCAGCGCAACAATCTCGCCCGGCGCCTGCGTGAAAGGATTCAGGAAGCGCGGGACCATCTGGAAGCGCG
GTTGCCGATCTATCTGGTGTTTACCAAATGCGACCTGATCGAGGGCTTCACGACTTTTTTCGAGCATCTC
GATCCGCAGCGGCAGAGCGACGTGCTCGGTCATACCTTCCCGCATCAGCAACCCAGTGATGTGAACTGGG
GCGTTCAGTTCGATGCCGCCCTGAATGAGCTGTGTCGCCACTGGCTGCAGGTCGGTGACGACGAGATCGT
GCAGCGCGATGTCGTCGAGACCCGGCGCGATGTCGCCGCCTTCCGGTTTCCGCTCGAGCTCGCCGCGCTG
CGCGATCCTCTGACGCGTTTCGTCGATGCGCTGACCAATGCCAATCCTTACCAGAGTGCGCCGCTGCTGC
GTGGTTTCTATTTCGTCAGCGCACTGCAGGAAGGCGATGCCATCGAGGGGGAGCACGCCAGTCGCGTCGG
CCGTCACTTCGCGCTGGCCAAGCCTGAAAGGCTGGCGGGCGAGCGCGTCAACCATGCCTTTTTCATCTCC
AACCTGTTTCGTCAGGTCATCATCGCTGATCAGCATCTGGCCGGGCTCTACTCCAGCGATGTGCGGGGGC
GGCGACGCAAGTTGCGCTGGACGTTGGCTGCCGCTGCGCTGGGGGCCATCGCCTGCACGCTCTGGATCAC
CTCTGCCGTGCGTAACCATGGCGAGATCGAGGCGATGTCACACACCTTCGCCGAGGCCGCGGCCGAGGAT
GATGATCGGCAGGCTCACTATGCGCGCTGGCATAGCCTCGATGCACTGCGCGACTGGGGCAGCCACTACT
ATCAGCGACATCAGAATGGGGGCGTGCCCTGGTCGATGGGCTGGGGGCTGTACCAGGGCGACGAGATCGA
GCCGGCGATCCGCAAGACGTATTTCGACCGCCTGCAAAGCGTGATGCTCGAACCGGTCGAGCAGAACCTG
ACCCGCTCGCTGTTCACGCTGACCACCATCGGGGTCTATCGGCGTACCGCCGATGAGTTGCATGCGGTGG
ACGGGCCGGACACCGTGGCGCCCTATGCCCGCCCGCGCGACAACAGCGCGGAGTCCCTGGCCAAGTTCGG
GCGCAATACGCTCGATACCTACCTGATGCTGTCGGACATGGAGCGTGCCGACATCGACAGTGACGTGTTG
CGCAACCGCCTTCCGGCCTTCTGGTACCCGGCGATCCAGCGCCGGACCGGAGCCGAGATAGATGAGGGGC
GGGCCGACTATCGCTATGCCGGTCGTCAGGTCGATTTCTACAGCCAGCAGATTCATGCCTCCGACGTGCC
ACGCATCACCTCCAATGCGTTCCTTGTCTCGAGCAGCCGCAACTACATCGACAGCCTGCTGGAACAAACG
TTGACCAGTACGGAGACCATCGTGCTCGAGTCCGACACCTTGTTTGCCTTCGGTCGTGGCGACTACGCCG
GCTTGCAGCAGGCGGGCCAGCAGGAGCTGGACAAATTGGCCGAACGTCTACTCAACACCCAGGACCTGGG
GCAGATCCTGATCACCGGTCATGCCGATCCCATCGGCAACGAGGCTGCCAATCAGCAGCTTTCTCTGCAG
CGCGCGATGACGGTCCGTCAGTACCTGATCGGGAAGGGCGTACCGGCCGGCCTCATCGAAGCCAAGGGGG
CGGGGAGTGAACGGCCGCTGGTCACTTGTGACGACGATCAGCCGCGTGCGCAGTTGATCGAATGCCTGGC
ACCGAATCGTCGGGTAGAGATCGAGGTGAGAAAGCAGCAGTGA

Protein ID: 92114383
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2262
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2541021..2545028 [-]
ProductImcF-like protein
NoteTssM
UniProt IDQ1QV96
KEGG IDcsa:Csal_2262
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-61, Aligned region: 184..433
IcmF-related [PF06761], Evalue: 1.00E-41, Aligned region: 490..561
IcmF-related [PF06761], Evalue: 1.00E-41, Aligned region: 693..950
DUF1215 [PF06744], Evalue: 8.90E-24, Aligned region: 631..664
DUF1215 [PF06744], Evalue: 8.90E-24, Aligned region: 1086..1194
AAA_16 [PF13191], Evalue: 0.00022, Aligned region: 110..257
AAA_16 [PF13191], Evalue: 0.00022, Aligned region: 268..322
AAA_16 [PF13191], Evalue: 0.00022, Aligned region: 625..656
AAA_16 [PF13191], Evalue: 0.00022, Aligned region: 908..924
DUF620 [PF04788], Evalue: 0.0057, Aligned region: 648..691
DUF620 [PF04788], Evalue: 0.0057, Aligned region: 1265..1321
Protein Sequence: 1335 a.a.     [Download]
>gi|92114383|ref|YP_574311.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MRFLRFLRSLKGFWPLSIVLWLVGLALCVLLLPLVTQERELIFIAMALVTALWLLVVVMRQYHRIRAERN
IENLVELEVHREAAENEPGDYQVLSERLKHAMAMQRAARSVDGGKASLYELPWYLVVGMSASGKTSLLTR
SSLSATMAGGGNLSAVSGTQHCDWYFSREAVMIDTAGRYLVEDRPASEFADFLKTLRKQRRKPAINGLVL
VVSLPELLEQSRQEAHALAEQLVTRVAEYRSCLGINPPVYLFFSKADLLPGFTRTFEALDAAERQTPWGL
TFSLDEVRRQGVASAFQQRFPGLVSALRARVDARMVEEGADADSELLRFPDYFAELFGVLSDFLEQFDIQ
NNTDQAPVLRGLYFTSALQSGPALPALLDEQTRDAFALAPSAEPDNTAHRGERSYFITDTFRNVIFPDRN
LSLYYSRDGDRRSLPTFMIGTVGALGVAAIAAQGWSAYNNKQWLDHLQNEVSALTAGNSTGYLAPQERRE
LLDDLERQLSAIERHRETGVPLRLDLGLYQGDALRAPLKQAWSALFERDVLEPLSMRLASQLRSLRAFGN
ADDDEPGTRGETDEAASASSAEPSATSTASAAVGEGGREIGADAMDRMQERSTSRPTLGSVPTSASEIGS
RARSELRSRTTDSARDAWYSARSSAETSLEEGLRDRTSALGTTVGSAGDEEASLTLSGEQGPSLSEEMLT
RLTQRDIEQLIESYSSLKLYLILTDPTSHRDQGDFVASALPRLWADQVGRRDLATSRDSIMDNAALYVHY
LQQGTAPALTRDEALVADSRDRLNAFLIDSSLVDREYLRYQLEVEKRFEPLTLSRMAPDMEGRLFYTSRA
VPAFYTQRVWHEYLRPAIIETVSGDLRRESDWVLDDENVDDAVQSKARFVSQLMTRYKRDYAIAWERFLD
DTHVADFDTLDQASVRLAQLSDLQGSPLRQVLEAVKANTGWDDPEASAEEGDAGGKAQDQSFWGRVMSVF
DGSDGEGPAVDPTTLPRINDGALARHFRPVTRMLSVDEATGSDNSVLNQYLLDLRQLKARVDNVRSAQDV
GRSSKSLIMATLAGQPTEINGLRNFVASRVDTSRAPLVQAMEPLFSDPVEDTWKALNEPARDQLNAAWDD
KIVTPWDQMIAGRYPVSDSVNEASVRDMEYFIDPDDGVMARFRQDEIGDLAGSGSGQRSSMVDPRMLSSI
DDATALGRVIDSLSDLQNGFELQMNPTAGLTDIILTIDGQRLHYRNNTQSWERLIWPGNGESFGARMDIV
NRDGQRHTVFDYPNRWGFLRMIESAHITSIDNARQRFSWRTYMGTVSFDVRNFGGVKISDLKRIKTLRIP
QVSGQ
 
Nucleotide Sequence: 4008 bp     [Download]
>gi|92112136|ref|NC_007963.1|:c2545028-2541021 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
ATGCGTTTTCTTCGCTTCCTGCGGTCGCTGAAAGGATTCTGGCCGCTCTCGATTGTGCTCTGGCTGGTGG
GGCTTGCGCTATGCGTGCTGTTGCTGCCGCTGGTGACCCAGGAGCGCGAGCTGATTTTCATCGCCATGGC
GCTGGTGACCGCACTGTGGCTGCTGGTCGTGGTGATGCGCCAGTACCATCGTATTCGCGCCGAGCGCAAC
ATCGAGAACCTGGTCGAGCTCGAGGTGCATCGTGAAGCCGCCGAGAACGAACCCGGCGATTATCAGGTGC
TCAGCGAGCGGCTCAAGCATGCCATGGCGATGCAGCGCGCTGCGCGCTCGGTGGACGGCGGCAAGGCCTC
TCTCTACGAGCTGCCGTGGTATCTGGTCGTGGGCATGTCGGCCTCGGGCAAGACCTCGTTGCTGACCCGC
TCGTCGCTGTCGGCGACCATGGCCGGTGGCGGCAACCTGTCGGCCGTCAGCGGCACCCAGCATTGTGACT
GGTACTTCAGCCGTGAGGCCGTGATGATCGACACGGCCGGTCGCTACCTGGTCGAGGATCGCCCCGCGAG
CGAGTTTGCCGACTTCCTCAAGACGCTGCGCAAGCAGCGGCGCAAGCCCGCGATCAACGGGTTGGTGCTG
GTGGTCAGCTTGCCGGAGTTGCTCGAACAGTCGCGTCAGGAAGCGCACGCCCTGGCCGAGCAGCTGGTGA
CGCGGGTGGCAGAGTATCGCAGCTGTCTGGGCATCAATCCGCCGGTCTATCTTTTCTTCAGCAAGGCCGA
CCTGTTGCCCGGCTTCACGCGCACCTTCGAGGCGCTGGACGCCGCCGAGCGTCAGACGCCCTGGGGGCTG
ACGTTCTCGCTCGATGAGGTGCGTCGCCAGGGTGTGGCAAGTGCGTTCCAGCAGCGTTTCCCGGGGCTGG
TCAGTGCGCTGCGTGCGCGGGTCGACGCGCGCATGGTGGAAGAGGGGGCCGACGCCGACAGCGAACTGCT
GCGCTTTCCCGATTACTTTGCCGAGCTGTTCGGGGTGCTCAGCGATTTCCTCGAGCAGTTCGATATCCAG
AACAATACCGATCAGGCGCCGGTACTGCGCGGTCTCTATTTCACCAGCGCCCTGCAGAGCGGTCCGGCAC
TGCCGGCACTGCTCGACGAGCAGACTCGCGATGCCTTCGCGCTGGCGCCGAGTGCGGAGCCCGACAATAC
GGCGCATCGCGGCGAGCGCAGCTACTTCATCACCGACACGTTCCGGAACGTCATCTTTCCGGACCGCAAT
CTGAGCCTTTACTACTCCCGGGACGGGGACCGGCGTTCGCTGCCGACCTTCATGATCGGTACCGTCGGCG
CTCTGGGGGTGGCGGCCATCGCCGCTCAGGGATGGTCGGCCTACAACAACAAGCAGTGGCTCGATCACCT
CCAGAATGAGGTGTCGGCGCTCACCGCCGGTAACAGCACCGGATATCTGGCACCGCAGGAGCGGCGTGAA
CTGCTCGACGATCTCGAGCGGCAATTGTCGGCGATCGAGCGGCATCGCGAGACCGGTGTGCCGTTGCGAC
TTGACCTGGGGCTCTATCAGGGCGATGCGTTGCGTGCGCCACTCAAGCAGGCATGGTCCGCACTCTTCGA
GCGCGATGTGCTGGAACCGCTCTCCATGCGGCTTGCAAGCCAGCTCCGTTCTCTGCGCGCGTTCGGCAAT
GCCGACGACGACGAGCCCGGCACACGCGGGGAAACGGATGAGGCTGCATCCGCATCGTCGGCCGAGCCGT
CGGCGACGAGTACTGCTTCCGCGGCCGTCGGCGAGGGGGGCCGCGAGATTGGTGCCGATGCCATGGATCG
CATGCAGGAGCGTTCCACATCGCGCCCGACGCTTGGCAGTGTGCCGACCAGCGCCTCCGAGATCGGCAGC
CGCGCGCGCAGCGAGCTGCGCTCGCGCACGACCGACAGCGCCCGGGATGCCTGGTATTCCGCGCGCAGCA
GTGCAGAGACTTCGCTCGAGGAGGGGTTGCGCGACCGCACCAGTGCACTGGGGACGACGGTCGGGAGCGC
CGGAGACGAGGAGGCCTCTCTTACGCTCTCTGGCGAGCAGGGGCCGTCGCTCTCCGAGGAGATGTTGACC
AGGCTTACACAGCGGGACATCGAGCAACTGATCGAGAGCTACTCGTCGCTGAAGCTCTATCTGATTCTCA
CAGACCCGACGTCGCACCGCGACCAGGGCGATTTCGTTGCCTCGGCGCTGCCTCGGCTGTGGGCCGATCA
GGTCGGCCGCCGTGACCTGGCGACCTCTCGCGACAGCATCATGGACAACGCCGCGCTCTACGTGCACTAC
CTGCAGCAGGGCACGGCACCCGCGTTGACGCGTGACGAGGCGCTGGTCGCCGATAGCCGTGATCGGCTCA
ACGCCTTCCTCATCGACAGCAGCCTCGTTGACCGGGAGTACCTGCGCTATCAGCTCGAAGTCGAGAAACG
CTTCGAGCCTCTGACGCTGTCGCGCATGGCGCCGGACATGGAGGGTCGCCTGTTCTACACCAGCCGCGCA
GTGCCGGCGTTCTACACCCAACGGGTCTGGCACGAGTATCTACGGCCGGCGATCATCGAAACCGTGTCCG
GTGATCTGCGGCGCGAATCGGACTGGGTGCTCGACGACGAGAATGTGGATGATGCGGTGCAATCGAAGGC
ACGCTTCGTCAGCCAGCTGATGACGCGCTACAAGCGTGACTACGCCATCGCCTGGGAACGCTTCCTCGAT
GATACTCATGTCGCCGACTTCGACACCCTGGACCAGGCCAGTGTCCGCCTGGCGCAGCTCAGCGATCTGC
AGGGCTCGCCCCTTCGTCAGGTGCTGGAGGCGGTCAAGGCCAATACGGGCTGGGATGATCCCGAGGCGTC
CGCAGAAGAGGGCGACGCCGGCGGCAAGGCGCAGGATCAAAGCTTCTGGGGGCGCGTGATGAGCGTCTTC
GACGGCAGCGATGGCGAGGGGCCGGCAGTGGACCCGACGACGTTGCCGCGGATCAACGATGGCGCGCTGG
CGCGTCACTTTCGCCCGGTGACGCGCATGCTATCCGTGGACGAGGCCACGGGAAGCGACAATTCCGTCCT
CAATCAATATCTGCTGGACCTGCGGCAGCTCAAGGCACGCGTGGATAACGTGCGCAGTGCTCAGGACGTG
GGGCGCAGCAGCAAGTCGCTGATCATGGCGACGCTCGCCGGCCAGCCCACCGAGATCAACGGCCTGCGCA
ACTTCGTGGCGTCGCGCGTGGATACCTCGCGGGCCCCCCTGGTGCAGGCGATGGAGCCGCTGTTCAGCGA
CCCGGTGGAAGATACCTGGAAAGCGCTGAACGAACCGGCTCGCGATCAACTCAATGCCGCCTGGGACGAC
AAGATCGTCACGCCCTGGGATCAGATGATCGCCGGGCGCTACCCGGTCAGCGATTCGGTCAACGAAGCTT
CCGTGCGCGACATGGAATACTTCATCGATCCCGACGACGGCGTAATGGCGCGGTTCCGGCAGGATGAGAT
CGGAGATCTCGCAGGTTCCGGAAGCGGTCAGCGCTCATCGATGGTGGATCCGCGCATGCTTTCGAGCATC
GACGACGCCACGGCGCTGGGACGGGTCATCGACAGCCTCTCGGACTTGCAGAACGGCTTCGAGCTGCAGA
TGAACCCCACCGCCGGTCTGACCGACATCATTCTGACCATCGACGGACAGCGTCTGCACTATCGCAATAA
CACCCAATCCTGGGAGCGGCTGATCTGGCCGGGCAACGGCGAGTCCTTCGGGGCCCGCATGGATATCGTC
AATCGCGATGGACAGCGTCATACCGTCTTCGACTACCCCAACCGCTGGGGCTTTCTGCGCATGATCGAAA
GCGCTCATATCACGTCCATCGACAATGCGCGCCAGCGTTTCAGCTGGCGAACCTACATGGGGACTGTCAG
CTTCGACGTGCGCAATTTCGGCGGTGTGAAGATCTCCGACCTGAAGCGGATAAAGACGCTGCGGATACCG
CAGGTGAGCGGTCAATGA