SecReT6
Protein ID: 92114384
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2263
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2545043..2545756 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ1QV95
KEGG IDcsa:Csal_2263
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.40E-57, Aligned region: 16..218
Protein Sequence: 237 a.a.     [Download]
>gi|92114384|ref|YP_574312.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MTEAFAHPSDIAEPRTLKTLSRDFISMVLMVRRGQQADSVERFLERVDQWLREFEEKARAENYSADAVQD
AQYALCAFLDESVLKGGAGNIREHVELHPFQYRYFGMHLAGEGFFDRLESLRGDVRTNLDVLEVYHLCLA
LGFEGKYSLENRDQLKYLASTLGRDIARYRKSASDSRESWKLPDQVGQLLRYEIPLWVYLLIIVAVCLIV
YGGLRWWLGSETDALIEQIQQLFDTHR
 
Nucleotide Sequence: 714 bp     [Download]
>gi|92112136|ref|NC_007963.1|:c2545756-2545043 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
ATGACCGAGGCCTTTGCTCACCCTTCCGATATTGCCGAACCCCGCACCCTCAAGACGCTGTCGCGCGATT
TCATCTCCATGGTGTTGATGGTGCGTCGAGGGCAGCAGGCCGACAGCGTCGAGCGCTTTCTCGAGCGGGT
GGACCAGTGGTTGCGCGAGTTCGAGGAGAAGGCGCGGGCCGAGAACTATAGCGCTGATGCGGTTCAGGAT
GCCCAGTATGCGCTGTGCGCCTTCCTCGATGAGAGTGTGCTCAAGGGCGGCGCGGGTAACATTCGCGAAC
ATGTCGAGCTGCATCCGTTCCAGTACCGCTATTTCGGGATGCATCTCGCGGGGGAAGGGTTCTTCGACCG
CCTGGAAAGCCTGCGCGGTGACGTACGTACCAACCTGGATGTGCTCGAGGTGTATCACCTCTGTCTGGCA
CTGGGCTTCGAAGGGAAGTACAGCCTGGAGAATCGCGACCAGCTGAAGTACCTGGCCAGCACGCTGGGCC
GAGACATCGCACGTTATCGCAAGAGCGCCAGCGACAGCCGCGAGAGCTGGAAGCTGCCGGATCAGGTGGG
TCAGTTGCTGCGTTACGAGATCCCGCTATGGGTCTACCTGCTGATCATCGTCGCGGTGTGCCTGATCGTC
TATGGCGGGCTGCGTTGGTGGCTGGGCAGCGAGACCGATGCGCTGATCGAGCAGATACAGCAACTCTTTG
ACACCCACCGCTGA