SecReT6
Protein ID: 92114386
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2265
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2547192..2547737 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDQ1QV93
KEGG IDcsa:Csal_2265
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.70E-32, Aligned region: 15..165
Protein Sequence: 181 a.a.     [Download]
>gi|92114386|ref|YP_574314.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MRASIRNWGMLLLLLSVTGCGVADRVGNRFEGTWAGDLFGNRERVRVTVDAAAMVNPDVDGDPLSVVIRI
YQLSERAPFATASPRALWGDGKSVLGSSLISQREITVLPSEEKVDTSALDPKAQFIGVAAFYRNTVDGRW
HVLFDADELRRDGLLSASEGIRLHLVDDRIEIERGHDLLDG
 
Nucleotide Sequence: 546 bp     [Download]
>gi|92112136|ref|NC_007963.1|:c2547737-2547192 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
ATGAGAGCGTCCATACGCAATTGGGGAATGCTATTACTTCTGCTTTCGGTCACGGGATGCGGGGTGGCGG
ATCGAGTCGGCAATCGCTTCGAGGGAACCTGGGCGGGCGACTTGTTCGGAAATCGCGAGCGGGTACGCGT
GACCGTCGATGCCGCTGCGATGGTGAACCCGGACGTGGATGGCGATCCGCTATCTGTCGTGATTCGCATT
TATCAGCTTTCCGAGCGAGCCCCTTTCGCCACGGCCTCGCCGCGCGCGCTCTGGGGAGATGGCAAGAGCG
TTCTCGGGAGCAGTCTGATTTCCCAGCGCGAGATCACGGTTCTGCCGAGCGAGGAGAAAGTCGATACCTC
GGCACTCGACCCCAAGGCGCAGTTCATCGGCGTGGCGGCGTTTTATCGGAACACCGTCGATGGGCGGTGG
CATGTCCTTTTCGATGCCGACGAACTGCGCCGTGATGGTTTGCTGAGCGCCTCCGAGGGCATTCGTCTGC
ATCTCGTCGATGACCGCATCGAGATCGAAAGAGGCCATGACCTGCTGGATGGCTGA