SecReT6
Protein ID: 92114389
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2268
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2549491..2550024 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ1QV90
KEGG IDcsa:Csal_2268
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.20E-62, Aligned region: 11..165
Protein Sequence: 177 a.a.     [Download]
>gi|92114389|ref|YP_574317.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MAKNESTQHKLSRVRAPRVHLTYDVEIGDSIEKKELPFVVGVMGDYSGNPLEPLPRLKDRKFVNIDRDNF
DSVMKGIKPRLSYRVDNTLANDGSQLPVELNFKRMEDFEPQEVVRQVEPLRKLLEVRNKLADLRNKMGGN
DKLEELLMDVLQNTDKLQTLGEELGREAAAKPQDEKE
 
Nucleotide Sequence: 534 bp     [Download]
>gi|92112136|ref|NC_007963.1|:2549491-2550024 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
ATGGCCAAGAACGAAAGCACCCAGCACAAACTTTCCCGCGTGAGGGCACCCCGTGTGCACCTGACCTATG
ACGTCGAGATCGGCGACAGCATCGAGAAGAAGGAGCTGCCGTTCGTGGTCGGTGTCATGGGCGACTATTC
GGGCAACCCGCTCGAGCCGCTGCCGCGCCTGAAGGACCGCAAGTTCGTCAACATCGACCGTGACAACTTC
GACAGCGTCATGAAGGGCATCAAGCCGCGACTGAGCTATCGCGTCGACAACACGCTCGCCAACGACGGCT
CGCAGCTTCCGGTGGAGCTCAACTTCAAGCGAATGGAAGATTTCGAGCCCCAGGAGGTCGTGCGCCAGGT
CGAGCCGTTGCGCAAGCTGCTCGAGGTTCGCAACAAGCTGGCAGACCTGCGCAACAAGATGGGCGGCAAC
GACAAGCTCGAAGAACTGTTGATGGACGTTCTTCAGAACACCGACAAGCTGCAGACCCTGGGCGAAGAGC
TGGGTCGGGAAGCGGCTGCGAAACCGCAGGACGAAAAGGAATAA