SecReT6
Protein ID: 92114390
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2269
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2550036..2551535 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ1QV89
KEGG IDcsa:Csal_2269
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-197, Aligned region: 71..493
Protein Sequence: 499 a.a.     [Download]
>gi|92114390|ref|YP_574318.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MADNQTDKTSQTDSQEVFAPETSLLDSIISESRVARSETERTRTRDLIDELVNQVLEGEVTPSKDLIAVL
DSRIAEIDALLSDQLNEVMHASEFQQLEASWRGLKYLTDQSETSTNMKIHMLNASKKDLVKDLKSASEFD
QSALFKKVYEEEYGTFGGAPYGMLIGDYEFGRHPQDMYLLEQVSHVAAAAHAPFISSASPELFGWDSFTD
MTGPRDLSKIFDTVEYAKWKSFRNSEDARYVGLTLPHVLGRLPYGEDTTPVEEFNFTENVDGRDHHKYLW
MNAAYTMGARVTDAFSKYGWCVAIRGVEGGGLVEDLPTHTFQTDDGEVALKCPTEISITDRREKELSDLG
FIPLVHCKGTDYAAFFGTQSAQLPKQYNTDVANANARLSSQLQYIFATSRIAHFMKAIMRDKVGSFASRQ
NVEDYLNEWLSQYVLLDDNAGQEAKAQYPLREARVEVAEVPGKPGSYKAVTFLRPHYQLDELTASLRLVS
ELPQSTRGS
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|92112136|ref|NC_007963.1|:2550036-2551535 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
ATGGCCGACAATCAGACCGACAAGACATCTCAGACCGACAGCCAGGAAGTTTTCGCACCGGAAACATCAC
TGCTGGACAGCATCATTTCCGAAAGCCGCGTGGCGCGTTCGGAAACCGAGCGCACCCGGACCCGCGACCT
GATCGACGAGCTGGTCAACCAGGTGCTCGAAGGCGAAGTCACGCCGAGCAAGGACCTGATCGCGGTCCTC
GACTCGCGTATCGCGGAAATCGATGCTCTGCTGTCCGATCAGCTCAATGAAGTCATGCACGCCAGCGAGT
TCCAGCAACTCGAGGCTTCCTGGCGCGGTCTGAAATATCTGACCGATCAATCCGAGACCAGCACCAACAT
GAAAATCCACATGTTGAATGCGTCCAAGAAGGACCTGGTCAAGGACCTCAAGTCGGCGTCCGAGTTCGAC
CAGAGCGCGCTGTTCAAGAAGGTCTACGAAGAAGAGTACGGCACCTTCGGCGGCGCCCCCTACGGCATGC
TGATCGGAGATTACGAATTCGGCCGCCACCCGCAGGACATGTATCTGCTGGAACAGGTCTCTCATGTCGC
GGCTGCCGCACACGCCCCCTTCATCTCCTCGGCCTCGCCGGAGCTGTTCGGCTGGGACTCCTTCACCGAC
ATGACCGGCCCGCGCGATCTGTCGAAGATCTTCGACACCGTCGAGTATGCCAAGTGGAAGTCGTTCCGCA
ATTCCGAAGACGCGCGCTACGTGGGCCTGACCCTGCCCCACGTACTGGGCCGCTTGCCCTACGGCGAGGA
CACCACCCCGGTGGAAGAATTCAACTTCACCGAGAACGTCGACGGTCGCGACCACCACAAGTACCTGTGG
ATGAACGCCGCCTATACCATGGGCGCCCGCGTCACCGATGCATTTTCCAAGTACGGCTGGTGCGTCGCGA
TCCGCGGTGTCGAAGGTGGCGGTCTGGTCGAGGACCTGCCGACCCACACCTTCCAGACCGACGATGGTGA
AGTGGCGCTGAAGTGCCCCACCGAGATCTCGATCACCGACCGTCGCGAAAAGGAGTTGTCCGACCTGGGC
TTCATCCCGCTGGTGCATTGCAAGGGCACCGACTATGCGGCGTTCTTCGGCACCCAGTCCGCGCAGTTGC
CCAAGCAGTACAACACCGATGTGGCCAACGCCAACGCGCGCCTCTCCTCGCAGCTGCAGTACATCTTCGC
CACCTCGCGTATCGCCCACTTCATGAAAGCCATCATGCGCGACAAGGTCGGCAGCTTCGCGTCCCGCCAG
AACGTCGAGGACTATCTCAACGAGTGGCTGTCGCAGTACGTGCTGCTGGACGACAACGCCGGCCAGGAAG
CCAAGGCTCAATACCCGTTGCGTGAGGCACGTGTGGAAGTCGCCGAGGTGCCCGGCAAGCCTGGTTCATA
CAAGGCGGTCACCTTCCTGCGTCCGCACTATCAGCTAGACGAGCTGACCGCATCACTGCGCCTGGTTTCC
GAACTGCCGCAGTCGACGCGAGGCTCCTGA