SecReT6
Protein ID: 92114391
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2270
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2551658..2552140 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ1QV88
KEGG IDcsa:Csal_2270
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.70E-18, Aligned region: 34..140
Protein Sequence: 160 a.a.     [Download]
>gi|92114391|ref|YP_574319.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MSESLQMIPTLLDRLLDDAPQHSSEVQPGHRCSLADYKQSVVRDLELLVNTRRELVAEELDAWPTLQGTL
LDYGLPDFISRGVRSTEDRRLIQRQLERTIEQGDRRFSSVHVQLLNQDSHDRILQFRIEAVLSLSEASQR
VAFDAVLQVNTRQYKVQNLI
 
Nucleotide Sequence: 483 bp     [Download]
>gi|92112136|ref|NC_007963.1|:2551658-2552140 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
ATGAGCGAATCGTTGCAGATGATCCCCACCCTGCTCGATCGTCTACTCGACGATGCCCCGCAGCACTCGA
GCGAAGTGCAGCCCGGCCATCGTTGCTCCTTGGCGGATTACAAGCAGTCGGTGGTAAGGGATCTGGAGCT
GCTGGTCAACACACGGCGGGAGCTGGTGGCGGAAGAGCTCGATGCCTGGCCCACGCTGCAGGGCACGTTG
CTCGACTACGGACTGCCTGACTTCATCAGTCGTGGCGTGCGCAGCACCGAGGATCGGCGACTGATCCAGC
GGCAGCTCGAGCGCACCATCGAGCAAGGAGACAGACGTTTCAGCAGCGTTCACGTGCAGCTGCTCAACCA
GGACAGCCACGACCGGATACTTCAGTTTCGTATCGAAGCGGTGCTGTCGCTGAGTGAAGCGAGTCAGCGC
GTCGCCTTCGATGCCGTCCTGCAAGTCAATACCCGTCAATACAAGGTGCAGAACCTGATCTGA