SecReT6
Protein ID: 92114393
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2272
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2554023..2555015 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ1QV86
KEGG IDcsa:Csal_2272
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.10E-93, Aligned region: 1..307
Protein Sequence: 330 a.a.     [Download]
>gi|92114393|ref|YP_574321.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MRLLRLHYSRTGRIDPENRPHQDPLRFRSLLSLNFPPSEISDLSFESDKVRSANGEPLSEVQVTFMGLVG
PSGVLPRPYTELLINRHIEKRDDAAHAFMDFFSHRMTALFYEAWQKYRFHIEYERKGSADFEDWLLHLVG
FTPKTMEKALDRDDDPTSLRRNLFSWFSGLLTQRPRNAGNLEAILEYTFQLPCRVAPFSGRWIRLDPAQY
TRLGQANARLGESAIAGTRVRDYQSAFRITFGPLDLDAYRSLLPETDAHQKLLKLVRFYAGIELDFEIEL
ILDKNCIPAPRLGARGNVSLGRLGWLNSSDRPAVSHGHALFDIPFDGATA
 
Nucleotide Sequence: 993 bp     [Download]
>gi|92112136|ref|NC_007963.1|:2554023-2555015 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
GTGCGCCTGTTGCGGCTGCACTACAGCCGCACCGGGCGCATCGATCCCGAAAATCGCCCGCATCAGGACC
CGCTGCGTTTTCGTTCGCTGCTCTCGCTCAACTTCCCCCCCAGCGAGATCAGTGACCTCTCCTTCGAGAG
CGACAAGGTCCGCTCCGCCAACGGCGAGCCGCTGAGTGAGGTCCAGGTCACGTTCATGGGGCTGGTGGGC
CCGTCCGGGGTCCTGCCGCGCCCCTATACCGAACTGCTGATCAACCGGCATATCGAAAAACGCGACGATG
CCGCCCATGCGTTCATGGATTTCTTCTCGCACCGCATGACGGCGCTCTTCTACGAGGCGTGGCAGAAATA
TCGCTTTCATATCGAATACGAGCGCAAGGGCAGCGCCGACTTCGAAGACTGGCTGCTGCACCTGGTGGGC
TTCACGCCCAAGACCATGGAAAAAGCGCTCGATCGCGATGACGACCCGACGTCGCTGCGACGCAACCTGT
TCAGCTGGTTTTCCGGGCTCTTGACCCAGCGCCCACGCAATGCCGGCAACCTCGAGGCGATTCTGGAATA
CACCTTCCAGCTGCCCTGCCGGGTCGCGCCATTTTCCGGCCGCTGGATACGCCTAGACCCGGCGCAGTAC
ACCCGGCTCGGACAGGCCAACGCCAGGCTTGGCGAAAGCGCCATCGCGGGGACACGGGTGCGCGACTACC
AATCGGCCTTCCGGATCACCTTTGGCCCACTCGACCTGGATGCCTACCGTTCGTTGCTGCCCGAGACCGA
TGCCCACCAGAAGCTGCTGAAACTGGTGCGCTTCTATGCCGGCATCGAACTCGATTTCGAGATCGAGCTC
ATTCTCGACAAGAACTGCATTCCTGCCCCCCGGCTGGGCGCGAGGGGCAACGTCAGCCTGGGACGCCTGG
GTTGGCTCAACTCGAGTGATCGACCGGCCGTCTCCCACGGCCATGCACTCTTCGACATTCCCTTTGATGG
AGCCACGGCGTGA