SecReT6
Protein ID: 92114394
SecReT6 ID123
T6SS typei4b
Gene symbol-
Locus tagCsal_2273
StrainChromohalobacter salexigens DSM 3043
Repliconchromosome [GenBank: NC_007963] [Browse all T6SS(s) in this replicon]
Location [Strand]2555012..2557681 [+]
ProductATPase AAA-2
NoteTssH
UniProt IDQ1QV85
KEGG IDcsa:Csal_2273
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-41, Aligned region: 237..254
AAA_2 [PF07724], Evalue: 2.00E-41, Aligned region: 620..788
AAA [PF00004], Evalue: 9.70E-18, Aligned region: 237..349
AAA [PF00004], Evalue: 9.70E-18, Aligned region: 626..710
ClpB_D2-small [PF10431], Evalue: 2.50E-14, Aligned region: 131..144
ClpB_D2-small [PF10431], Evalue: 2.50E-14, Aligned region: 382..405
ClpB_D2-small [PF10431], Evalue: 2.50E-14, Aligned region: 794..868
AAA_5 [PF07728], Evalue: 2.40E-13, Aligned region: 237..257
AAA_5 [PF07728], Evalue: 2.40E-13, Aligned region: 312..367
AAA_5 [PF07728], Evalue: 2.40E-13, Aligned region: 625..735
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 214..254
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 281..315
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 620..668
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 690..714
AAA_22 [PF13401], Evalue: 5.60E-09, Aligned region: 236..329
AAA_22 [PF13401], Evalue: 5.60E-09, Aligned region: 362..406
AAA_22 [PF13401], Evalue: 5.60E-09, Aligned region: 623..662
Clp_N [PF02861], Evalue: 5.20E-07, Aligned region: 22..71
Clp_N [PF02861], Evalue: 5.20E-07, Aligned region: 103..128
AAA_14 [PF13173], Evalue: 1.60E-06, Aligned region: 18..75
AAA_14 [PF13173], Evalue: 1.60E-06, Aligned region: 237..340
AAA_14 [PF13173], Evalue: 1.60E-06, Aligned region: 624..706
AAA_14 [PF13173], Evalue: 1.60E-06, Aligned region: 841..864
Arch_ATPase [PF01637], Evalue: 4.50E-06, Aligned region: 216..251
Arch_ATPase [PF01637], Evalue: 4.50E-06, Aligned region: 290..391
Arch_ATPase [PF01637], Evalue: 4.50E-06, Aligned region: 624..669
Sigma54_activat [PF00158], Evalue: 1.60E-05, Aligned region: 220..251
Sigma54_activat [PF00158], Evalue: 1.60E-05, Aligned region: 625..742
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 237..258
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 623..647
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 231..259
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 625..646
AAA_25 [PF13481], Evalue: 0.00038, Aligned region: 237..261
AAA_25 [PF13481], Evalue: 0.00038, Aligned region: 448..496
AAA_25 [PF13481], Evalue: 0.00038, Aligned region: 623..646
NACHT [PF05729], Evalue: 0.00069, Aligned region: 124..151
NACHT [PF05729], Evalue: 0.00069, Aligned region: 237..263
NACHT [PF05729], Evalue: 0.00069, Aligned region: 625..650
IncA [PF04156], Evalue: 0.0023, Aligned region: 447..545
AAA_29 [PF13555], Evalue: 0.0034, Aligned region: 230..253
AAA_29 [PF13555], Evalue: 0.0034, Aligned region: 623..636
Zeta_toxin [PF06414], Evalue: 0.0037, Aligned region: 232..254
Zeta_toxin [PF06414], Evalue: 0.0037, Aligned region: 454..473
Zeta_toxin [PF06414], Evalue: 0.0037, Aligned region: 619..665
Zeta_toxin [PF06414], Evalue: 0.0037, Aligned region: 799..817
AAA_17 [PF13207], Evalue: 0.0039, Aligned region: 109..132
AAA_17 [PF13207], Evalue: 0.0039, Aligned region: 237..300
AAA_17 [PF13207], Evalue: 0.0039, Aligned region: 626..663
NPV_P10 [PF05531], Evalue: 0.0041, Aligned region: 477..519
NPV_P10 [PF05531], Evalue: 0.0041, Aligned region: 828..857
AAA_18 [PF13238], Evalue: 0.0054, Aligned region: 237..257
AAA_18 [PF13238], Evalue: 0.0054, Aligned region: 627..650
Protein Sequence: 889 a.a.     [Download]
>gi|92114394|ref|YP_574322.1| unnamed protein product [Chromohalobacter salexigens DSM 3043]
MSLKSLFDKLNDPCREATEGAAALCLAERQYDVDIEHLLLKLLDSDDNDFLRIARHYDVSLDRLATQLED
TVSTFKTGNTRTPALSPRITRLIERAWVIASIDHGEAQIRSGHLLLALLKDDELRRVLLDGARELERINV
DDLQAHLDDLIGGSSEDQYVRPLGEGANEDGQSARQASDARSEGSRSGKSKTPALDQYTIDLTGNARAGR
IDPVLGREEEVRQMVDILTRRRQNNPILTGEAGVGKTAVVEGLALRIVDGDVPPPLKNVELRTLDLGLLQ
AGAGVKGEFENRLKNVIEETRRSLHPIILFIDEAHTLIGSGGQAGQGDAANLLKPALARGELRTIAATTW
AEFKKYFEKDAALARRFQVVKVEEPAEPVAINMLRGLNERMQDHHKVTILDDAIVQAVRLSHRYITGRQL
PDKAVSVLDTACARVALAQSSQPAALEDAYRRVDNLNSEIAVLQREQREGSDHAETLAALDEQLTATQGE
IDDLRARWEREQEIVTRLKALEAEREAIEAGQQSGDVDALSRQIGEVRRELAEVQGEHSLVHGHVDGNVI
AEVISNWTGIPLGKMMRDEIATVQRLPELLGERVLGQDHALAEIGKRIAISRARMEDPNKPIGVFLLLGP
SGVGKTETALSLADTLYGGERNVITINMSEYQEAHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLL
DEVEKAHPDVLELFFQVFDKGVLDDGEGREINFRNTVILLTSNVGTDDIMQQCLGAESLPAPGAIVDSLR
DQLNAVFKPAFLGRLNIIPYYPVQKEILHNIVRLKLDRIKHRFEYNHRADFDYDPAIIEAIAERCTDSDS
GARNIDNILSGSLMPTIATQVLDRMASGESIEQLTVSLDAQGEFAYALR
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|92112136|ref|NC_007963.1|:2555012-2557681 Chromohalobacter salexigens DSM 3043 chromosome, complete genome
GTGAGTCTCAAATCCCTCTTCGACAAACTCAACGATCCCTGCCGCGAGGCCACTGAAGGCGCCGCCGCGC
TATGCCTGGCGGAGCGCCAGTACGACGTGGACATCGAACACCTGTTGCTCAAGCTGCTCGACAGCGACGA
CAACGATTTCCTGCGCATCGCACGGCACTACGACGTGTCGCTCGATCGCCTGGCGACCCAGCTCGAGGAC
ACGGTGTCCACCTTCAAGACCGGCAATACCCGAACGCCTGCCCTGTCGCCACGCATCACTCGGCTGATCG
AGCGTGCCTGGGTCATCGCCTCGATCGATCATGGCGAAGCCCAGATTCGCAGCGGCCACCTGCTGCTGGC
ATTGCTGAAGGACGATGAACTGCGCCGCGTACTGCTCGATGGGGCCCGTGAGCTGGAACGCATCAATGTC
GACGACCTGCAGGCACACCTCGATGACCTGATCGGGGGCAGCAGCGAAGATCAGTACGTACGCCCGCTCG
GCGAAGGAGCGAACGAGGATGGCCAGAGCGCTCGCCAGGCATCGGACGCCAGGAGCGAAGGCAGTCGCTC
CGGCAAGAGCAAGACCCCGGCGCTGGATCAATACACCATCGACCTGACCGGCAACGCCCGCGCCGGTCGC
ATCGACCCGGTGCTCGGCCGCGAGGAAGAAGTGCGCCAGATGGTGGACATCCTCACCCGGCGTCGCCAGA
ACAACCCGATCCTCACCGGGGAGGCCGGCGTCGGCAAGACCGCCGTGGTCGAAGGCCTGGCACTGCGCAT
CGTCGACGGCGATGTACCGCCACCGCTCAAGAACGTCGAGCTGCGCACGCTCGATCTGGGGCTTCTGCAA
GCCGGCGCCGGGGTCAAGGGCGAGTTCGAGAACCGGCTCAAGAACGTGATCGAGGAAACCAGGCGCAGCC
TGCACCCGATCATCCTGTTCATCGACGAGGCCCACACCCTGATCGGCAGCGGCGGACAGGCCGGTCAGGG
CGATGCCGCCAACCTGCTCAAGCCGGCGCTGGCACGCGGGGAGCTGCGCACCATCGCCGCCACCACCTGG
GCGGAATTCAAGAAGTACTTCGAGAAGGACGCCGCGCTGGCCCGTCGCTTTCAGGTCGTCAAGGTCGAGG
AACCGGCCGAACCGGTGGCCATCAACATGCTGCGCGGTCTGAACGAGCGCATGCAGGACCACCACAAGGT
GACCATTCTCGATGACGCCATCGTCCAGGCCGTACGCCTGTCGCACCGCTACATCACTGGCCGCCAGTTG
CCGGACAAGGCCGTCAGCGTGCTCGATACCGCCTGCGCGCGGGTCGCCCTGGCACAATCGTCGCAGCCGG
CGGCGCTCGAAGATGCCTACCGCCGCGTCGACAACCTCAACAGCGAGATTGCCGTTCTCCAGCGCGAACA
GCGTGAAGGCAGCGATCACGCCGAAACGCTGGCCGCGCTCGACGAACAGCTTACCGCGACCCAGGGCGAG
ATAGACGACCTGCGCGCACGCTGGGAGCGCGAGCAGGAGATCGTGACGCGCCTCAAAGCGCTGGAAGCGG
AACGCGAAGCCATCGAGGCCGGCCAGCAAAGCGGCGATGTCGACGCGTTGAGCCGGCAGATCGGCGAGGT
CCGGCGCGAACTGGCCGAGGTCCAGGGCGAGCACTCGCTGGTCCACGGCCATGTCGACGGCAACGTGATC
GCCGAGGTGATTTCCAACTGGACCGGCATTCCACTCGGCAAGATGATGCGCGACGAGATCGCCACCGTGC
AGCGCCTCCCCGAACTGCTCGGCGAGCGCGTGCTGGGCCAGGACCATGCGCTGGCCGAGATCGGCAAGCG
CATCGCGATCTCGCGGGCCCGGATGGAGGACCCCAACAAGCCGATCGGAGTCTTCCTGCTGCTCGGCCCC
AGCGGCGTCGGCAAGACCGAAACCGCGCTGTCGCTGGCCGATACTCTCTACGGTGGTGAACGTAACGTCA
TCACCATCAACATGTCCGAATATCAGGAGGCGCATACCGTCTCCAGCCTCAAGGGCTCACCTCCCGGGTA
CGTCGGCTACGGCGAAGGCGGCGTGCTGACCGAAGCGGTGCGCCGCAAGCCCTACAGCGTGGTACTGCTG
GATGAAGTCGAGAAAGCGCACCCGGACGTGCTGGAGCTGTTCTTCCAGGTGTTCGACAAGGGCGTGCTGG
ACGACGGCGAAGGCCGCGAGATCAACTTCCGCAACACCGTGATCCTGCTCACGTCCAACGTCGGTACCGA
CGACATCATGCAGCAGTGTCTGGGCGCCGAGTCCCTGCCCGCCCCGGGTGCGATCGTCGACAGCCTGCGC
GATCAGCTCAACGCCGTGTTCAAGCCGGCGTTTTTGGGCCGTTTGAACATCATTCCCTACTACCCGGTGC
AGAAAGAGATTCTGCACAACATCGTTCGGCTCAAGCTCGACCGCATCAAGCATCGCTTCGAATACAACCA
CCGCGCCGACTTCGACTACGATCCGGCGATCATCGAAGCCATCGCCGAGCGCTGCACCGACAGCGACAGC
GGTGCGCGCAATATCGACAACATTCTCTCCGGCAGCCTGATGCCGACCATCGCCACGCAGGTACTGGACC
GCATGGCCAGCGGTGAATCCATCGAACAGCTCACGGTCAGCCTCGACGCTCAGGGGGAGTTCGCATATGC
CCTGCGCTGA