SecReT6
Protein ID: 94309562
SecReT6 ID124
T6SS typei2
Gene symbol-
Locus tagRmet_0617
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T6SS(s) in this replicon]
Location [Strand]676887..677321 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ1LQS3
KEGG IDrme:Rmet_0617
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.70E-17, Aligned region: 33..116
Protein Sequence: 144 a.a.     [Download]
>gi|94309562|ref|YP_582772.1| unnamed protein product [Cupriavidus metallidurans CH34]
MTRGGPGLFEAVTGFFANGVAVDELDASTQTFLSVQDNIQRILNSRRGGLAHLPDYGLGDLSRIYRHLPA
SAHTLKREIETTLLRYEPRLKALDLEIEEPEPGMLLSFTMTCHLHQSGLVQFGTHFMPDGKTRLKLLRSA
HDHD
 
Nucleotide Sequence: 435 bp     [Download]
>gi|94308945|ref|NC_007973.1|:c677321-676887 Cupriavidus metallidurans CH34 chromosome, complete genome
GTGACGCGCGGCGGGCCGGGTCTCTTCGAAGCCGTCACCGGGTTCTTTGCGAATGGCGTTGCCGTTGACG
AGTTAGATGCGTCGACCCAGACCTTCCTGTCGGTCCAGGACAACATCCAGCGCATCCTTAACAGTCGGCG
CGGTGGCCTTGCGCATCTGCCTGACTACGGACTGGGAGATCTGTCCCGCATCTACCGCCACCTGCCTGCC
TCGGCGCACACGCTCAAGCGGGAAATTGAGACGACACTCCTGCGCTACGAGCCGAGATTGAAGGCCCTCG
ACCTCGAGATCGAGGAACCCGAACCGGGCATGCTGTTGAGCTTCACGATGACCTGCCATTTGCACCAATC
TGGACTGGTGCAATTCGGCACGCATTTCATGCCGGACGGCAAGACACGGCTCAAGCTGCTGCGGTCGGCG
CACGATCATGACTAA