SecReT6
Protein ID: 94309563
SecReT6 ID124
T6SS typei2
Gene symbolclpB
Locus tagRmet_0618
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T6SS(s) in this replicon]
Location [Strand]677318..679999 [-]
ProductChaperone ClpB
NoteTssH
UniProt IDQ1LQS2
KEGG IDrme:Rmet_0618
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-41, Aligned region: 229..268
AAA_2 [PF07724], Evalue: 1.40E-41, Aligned region: 612..781
AAA [PF00004], Evalue: 5.00E-21, Aligned region: 231..343
AAA [PF00004], Evalue: 5.00E-21, Aligned region: 617..735
AAA_5 [PF07728], Evalue: 1.60E-15, Aligned region: 231..251
AAA_5 [PF07728], Evalue: 1.60E-15, Aligned region: 305..361
AAA_5 [PF07728], Evalue: 1.60E-15, Aligned region: 616..736
ClpB_D2-small [PF10431], Evalue: 9.10E-12, Aligned region: 376..400
ClpB_D2-small [PF10431], Evalue: 9.10E-12, Aligned region: 787..859
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 140..169
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 208..254
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 276..309
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 472..591
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 585..659
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 680..711
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 775..821
AAA_22 [PF13401], Evalue: 2.00E-10, Aligned region: 230..316
AAA_22 [PF13401], Evalue: 2.00E-10, Aligned region: 519..590
AAA_22 [PF13401], Evalue: 2.00E-10, Aligned region: 615..635
AAA_22 [PF13401], Evalue: 2.00E-10, Aligned region: 677..710
AAA_17 [PF13207], Evalue: 1.00E-07, Aligned region: 231..288
AAA_17 [PF13207], Evalue: 1.00E-07, Aligned region: 615..651
AAA_17 [PF13207], Evalue: 1.00E-07, Aligned region: 803..870
Arch_ATPase [PF01637], Evalue: 4.40E-07, Aligned region: 209..247
Arch_ATPase [PF01637], Evalue: 4.40E-07, Aligned region: 283..381
Arch_ATPase [PF01637], Evalue: 4.40E-07, Aligned region: 614..657
Arch_ATPase [PF01637], Evalue: 4.40E-07, Aligned region: 687..703
Zeta_toxin [PF06414], Evalue: 1.20E-06, Aligned region: 227..251
Zeta_toxin [PF06414], Evalue: 1.20E-06, Aligned region: 604..656
NACHT [PF05729], Evalue: 1.50E-06, Aligned region: 231..259
NACHT [PF05729], Evalue: 1.50E-06, Aligned region: 616..637
IstB_IS21 [PF01695], Evalue: 2.80E-06, Aligned region: 225..260
IstB_IS21 [PF01695], Evalue: 2.80E-06, Aligned region: 616..634
Sigma54_activat [PF00158], Evalue: 8.00E-06, Aligned region: 226..255
Sigma54_activat [PF00158], Evalue: 8.00E-06, Aligned region: 616..734
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 231..321
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 615..706
AAA_25 [PF13481], Evalue: 2.80E-05, Aligned region: 231..270
AAA_25 [PF13481], Evalue: 2.80E-05, Aligned region: 285..319
AAA_25 [PF13481], Evalue: 2.80E-05, Aligned region: 469..479
AAA_25 [PF13481], Evalue: 2.80E-05, Aligned region: 614..640
AAA_18 [PF13238], Evalue: 4.40E-05, Aligned region: 231..250
AAA_18 [PF13238], Evalue: 4.40E-05, Aligned region: 617..646
Clp_N [PF02861], Evalue: 5.70E-05, Aligned region: 24..65
Clp_N [PF02861], Evalue: 5.70E-05, Aligned region: 115..129
AAA_19 [PF13245], Evalue: 6.50E-05, Aligned region: 228..252
AAA_19 [PF13245], Evalue: 6.50E-05, Aligned region: 614..635
AAA_33 [PF13671], Evalue: 0.00031, Aligned region: 231..250
AAA_33 [PF13671], Evalue: 0.00031, Aligned region: 615..634
Acetyltransf_6 [PF13480], Evalue: 0.00035, Aligned region: 389..412
Acetyltransf_6 [PF13480], Evalue: 0.00035, Aligned region: 473..555
AAA_29 [PF13555], Evalue: 0.00063, Aligned region: 225..247
AAA_29 [PF13555], Evalue: 0.00063, Aligned region: 614..641
RNA_helicase [PF00910], Evalue: 0.001, Aligned region: 232..253
RNA_helicase [PF00910], Evalue: 0.001, Aligned region: 617..637
AAA_28 [PF13521], Evalue: 0.0015, Aligned region: 231..306
AAA_28 [PF13521], Evalue: 0.0015, Aligned region: 494..532
AAA_28 [PF13521], Evalue: 0.0015, Aligned region: 532..560
AAA_28 [PF13521], Evalue: 0.0015, Aligned region: 616..636
SRP54 [PF00448], Evalue: 0.0016, Aligned region: 231..256
SRP54 [PF00448], Evalue: 0.0016, Aligned region: 615..650
DUF258 [PF03193], Evalue: 0.0016, Aligned region: 218..250
DUF258 [PF03193], Evalue: 0.0016, Aligned region: 615..633
MobB [PF03205], Evalue: 0.0018, Aligned region: 232..260
MobB [PF03205], Evalue: 0.0018, Aligned region: 615..638
DnaB_C [PF03796], Evalue: 0.0033, Aligned region: 230..271
DnaB_C [PF03796], Evalue: 0.0033, Aligned region: 452..486
AAA_10 [PF12846], Evalue: 0.0051, Aligned region: 230..263
AAA_10 [PF12846], Evalue: 0.0051, Aligned region: 298..319
AAA_10 [PF12846], Evalue: 0.0051, Aligned region: 616..637
RuvB_N [PF05496], Evalue: 0.0053, Aligned region: 82..126
RuvB_N [PF05496], Evalue: 0.0053, Aligned region: 230..250
RuvB_N [PF05496], Evalue: 0.0053, Aligned region: 302..311
RuvB_N [PF05496], Evalue: 0.0053, Aligned region: 586..637
Mg_chelatase [PF01078], Evalue: 0.008, Aligned region: 144..188
Mg_chelatase [PF01078], Evalue: 0.008, Aligned region: 227..248
Mg_chelatase [PF01078], Evalue: 0.008, Aligned region: 616..637
Protein Sequence: 893 a.a.     [Download]
>gi|94309563|ref|YP_582773.1| clpB gene product [Cupriavidus metallidurans CH34]
MTTRDYSPFLRRLNDHCARALADAASLCETRAHRDIEVEHWLIKLMEQGDGDLLAILRRYELDVDGIWNG
LLAAVDHLPHDLRGRPGLSQRLGQWLEAAWMRASLESTAPGVDRSIRSAHLLAALAETPHLLRAPDAWPL
LSVSAAQIERLMPELDEISVEATSPITPSQGPATIATRRPAGQPDNSALSRFTTDVTQKARDGKIDPVFG
RDVEIRQMVDILARRRKNNPILVGEPGVGKTALVEGLALKIAEEDVPTAIRDVTVLTLDMGLLQAGAGVK
GEFEQRLKNVIEAVQQSPTPILLFIDEAHTLIGAGNTAGGADAANLLKPALARGELRTIAATTWSEYKQY
FERDAALERRFQMVKVDEPDDENACLMLRGLKDRYAQHHNVHITDAAVAAAVRLSRRYLTGRQLPDKAVD
LIDTAAARVRMSQEARPVAICTLEAERAALGVEYLALQQDQGATGEDKRNRLSAIETRLRELAIELGQLE
FELAAQKDAADKLMVLRAQWQAATDASERHDLASSIQAAHQVLAAHGQATLLHAEVAETVVAQVIADWTG
VPVDNLLSNELATLLELEARLGRVVVGQDEALAALGKSLRASKAGLKSEEAPLGVFLLVGPSGVGKTETA
RALADLMFGGERSLITINLSEYQEAHTVSQLKGSPPGYVGYGEGGILTEAVRQRPYSVVLLDEVEKAHRD
VLNLFYQVFDRGFMRDGEGRVIDFRNTVILMTSNLGSEQILAATDATTEAGVEIPASALMETIRPLLIDR
FQPALLARFQTIVYRPLAAEAMATIVGMKLAKVAERIERRFDVPLRCDDALVAELVRACLLPDSGARNID
SLLDQQILPVLSRELLIRMANRQVPASIRLSFSEEDGIGLDFDDAATTAEEYA
 
Nucleotide Sequence: 2682 bp     [Download]
>gi|94308945|ref|NC_007973.1|:c679999-677318 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGACCACCCGCGATTACTCTCCCTTTCTGCGACGCCTGAACGACCACTGCGCCCGTGCTCTGGCGGATG
CAGCCAGTCTTTGCGAAACCCGCGCGCACCGTGACATCGAGGTGGAGCACTGGCTGATCAAACTGATGGA
ACAGGGTGACGGCGACCTGCTTGCCATCCTGCGTCGCTACGAGCTGGATGTCGATGGGATCTGGAACGGA
CTGCTGGCTGCGGTCGACCACCTGCCGCATGACCTCCGGGGCAGGCCGGGGCTATCGCAGCGCCTGGGCC
AGTGGCTGGAGGCAGCGTGGATGCGCGCCTCGCTCGAATCCACGGCCCCGGGCGTAGACAGATCGATTCG
TTCGGCCCACTTGCTGGCGGCACTGGCGGAGACGCCGCACCTGTTGCGCGCCCCGGATGCCTGGCCGCTG
CTGAGCGTGTCTGCCGCGCAGATTGAGCGGCTGATGCCTGAACTGGACGAGATATCTGTCGAGGCAACAT
CGCCGATCACGCCTAGCCAGGGACCGGCGACCATCGCTACAAGGCGCCCTGCCGGCCAGCCCGACAACTC
TGCCCTCTCTCGTTTCACCACGGACGTCACGCAAAAGGCGCGCGATGGCAAGATCGACCCTGTGTTTGGC
CGCGACGTCGAGATCCGGCAGATGGTCGATATCCTCGCCCGGCGCCGTAAGAACAATCCGATTCTGGTCG
GCGAACCGGGGGTCGGCAAAACTGCGCTCGTCGAAGGGCTGGCGCTCAAGATCGCCGAAGAGGATGTGCC
CACGGCCATCCGGGACGTGACCGTACTCACCTTGGATATGGGCCTCCTGCAAGCCGGTGCGGGCGTCAAG
GGCGAGTTCGAGCAGCGCCTCAAGAATGTCATTGAAGCCGTCCAGCAGTCGCCGACGCCCATCCTGCTCT
TCATCGACGAGGCGCACACCCTGATTGGCGCCGGCAACACGGCCGGTGGCGCCGATGCCGCCAACCTGCT
CAAGCCTGCACTGGCACGGGGCGAACTACGCACGATCGCGGCAACCACCTGGTCCGAATACAAGCAGTAC
TTCGAGCGCGACGCGGCGCTGGAGCGCCGCTTCCAGATGGTCAAGGTCGATGAGCCCGATGATGAGAACG
CCTGCCTGATGTTGCGCGGGCTCAAGGATCGGTATGCACAGCACCACAACGTCCACATCACCGATGCCGC
CGTCGCAGCCGCCGTCCGTCTTTCACGTCGCTATCTGACTGGGCGCCAACTGCCCGACAAGGCTGTCGAC
CTGATCGACACGGCGGCTGCGCGGGTGCGCATGAGTCAGGAGGCCAGGCCCGTGGCGATCTGCACCCTTG
AAGCCGAACGCGCGGCGCTGGGGGTCGAGTACTTGGCGCTGCAGCAGGATCAGGGTGCCACCGGCGAGGA
CAAGCGCAATCGTCTGTCGGCGATCGAGACGCGCCTACGCGAACTTGCCATCGAACTCGGACAGCTTGAG
TTCGAATTAGCGGCGCAGAAGGACGCTGCCGACAAGCTGATGGTGCTGCGTGCCCAATGGCAGGCCGCTA
CCGACGCTTCCGAGCGCCACGATCTCGCGTCCTCCATTCAGGCTGCCCACCAGGTCCTGGCCGCGCACGG
TCAGGCGACACTTCTACATGCAGAAGTTGCTGAGACCGTCGTGGCGCAGGTAATTGCCGACTGGACCGGC
GTGCCGGTTGACAACCTGTTGTCGAATGAACTGGCCACCCTGCTGGAGCTGGAGGCACGCCTCGGACGGG
TCGTGGTCGGGCAGGACGAGGCGCTGGCCGCGCTCGGCAAAAGCCTGCGCGCCTCCAAGGCGGGCTTGAA
ATCCGAGGAGGCACCGCTGGGCGTCTTTCTCCTCGTGGGCCCTTCCGGGGTCGGCAAGACCGAAACGGCA
CGGGCACTGGCCGATCTCATGTTCGGCGGTGAACGCTCGCTCATCACGATCAACCTGTCGGAGTATCAGG
AAGCCCACACCGTATCGCAATTGAAGGGATCGCCGCCGGGCTATGTCGGCTATGGCGAGGGCGGCATCCT
GACTGAGGCTGTCCGTCAGCGCCCCTACAGCGTGGTCCTCCTGGATGAGGTGGAAAAGGCCCATCGGGAC
GTGCTCAACCTGTTCTACCAGGTCTTCGATCGCGGCTTCATGCGCGATGGCGAAGGCCGGGTCATTGATT
TCCGCAACACCGTCATCCTGATGACATCGAATCTCGGCAGCGAGCAAATCCTGGCGGCCACCGACGCCAC
AACGGAAGCTGGTGTGGAAATCCCCGCCAGCGCGCTGATGGAGACCATCCGGCCGCTCCTGATCGACCGC
TTCCAACCCGCGCTGCTGGCGCGCTTCCAGACCATTGTGTACCGGCCGCTCGCCGCGGAGGCCATGGCCA
CGATCGTAGGGATGAAGCTGGCCAAGGTGGCCGAGCGCATCGAACGCCGGTTCGACGTGCCGCTGCGCTG
CGACGACGCCCTGGTGGCCGAACTGGTGCGCGCCTGCCTGCTGCCTGACTCTGGCGCACGCAATATCGAC
AGCCTGCTCGACCAGCAGATCTTGCCCGTGCTGTCGCGTGAATTGCTGATACGCATGGCCAACAGGCAGG
TACCTGCGTCTATCCGGCTCTCGTTCTCCGAGGAGGACGGCATTGGGCTGGACTTCGATGATGCGGCAAC
CACCGCGGAGGAATACGCGTGA