SecReT6
Protein ID: 94309564
SecReT6 ID124
T6SS typei2
Gene symbol-
Locus tagRmet_0619
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T6SS(s) in this replicon]
Location [Strand]680084..680569 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ1LQS1
KEGG IDrme:Rmet_0619
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.60E-37, Aligned region: 6..147
Protein Sequence: 161 a.a.     [Download]
>gi|94309564|ref|YP_582774.1| unnamed protein product [Cupriavidus metallidurans CH34]
MAIPAYMWIKDDGGADIKGSVTVTEREGSVEVVAFDHSVNIPTDSNTGKLTGTRVHKPILFTKETDASTP
YLYKAVTSGQTLKSIEIKWYKIDDAGKEKEYFNTKLENVKVVGVTAKMLDIKNPAYEKHNHLEDVELRYE
RITWSYKDGNIIHADSWNERS
 
Nucleotide Sequence: 486 bp     [Download]
>gi|94308945|ref|NC_007973.1|:c680569-680084 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGGCAATTCCCGCATATATGTGGATCAAGGACGACGGTGGCGCCGATATCAAAGGCTCGGTCACCGTCA
CGGAGCGCGAGGGCAGCGTCGAAGTCGTGGCATTCGATCACTCGGTCAACATCCCGACCGACTCCAACAC
GGGCAAGCTGACCGGCACGCGCGTGCACAAGCCGATCCTGTTCACCAAGGAAACCGACGCTTCGACCCCG
TATCTATACAAGGCGGTCACCAGCGGCCAGACGCTCAAGTCGATCGAGATCAAGTGGTACAAAATTGACG
ACGCCGGCAAGGAGAAGGAGTACTTCAACACCAAGCTGGAGAACGTGAAGGTGGTTGGCGTGACGGCCAA
GATGCTGGACATCAAGAACCCGGCTTACGAAAAACACAATCACCTCGAAGACGTCGAGTTGCGCTACGAG
AGGATTACCTGGTCGTACAAGGACGGCAACATCATCCACGCCGACAGCTGGAACGAGCGCTCGTAA