SecReT6
Protein ID: 94309566
SecReT6 ID124
T6SS typei2
Gene symbol-
Locus tagRmet_0621
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T6SS(s) in this replicon]
Location [Strand]682313..682969 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ1LQR9
KEGG IDrme:Rmet_0621
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.20E-42, Aligned region: 11..209
Protein Sequence: 218 a.a.     [Download]
>gi|94309566|ref|YP_582776.1| unnamed protein product [Cupriavidus metallidurans CH34]
MTTLTTILPLALRDTALTVTELADEAAPDDSFAMFRKKCLEQVTRLREEFLAAGHAPAVVEDAAYAQCAL
LDEYALRRLTGDERSAWEREPLQVQEFHSHNAGEELIARIERRLAEAQPVIPLLVVFHAVLGLGFQGKFA
LEGNAAREALMHAIDERLQRAGVQKATGPVIVTAGKARGWRGLSLSPLAWVAIALVGAGLVYFALDRWLA
VSIARLAS
 
Nucleotide Sequence: 657 bp     [Download]
>gi|94308945|ref|NC_007973.1|:c682969-682313 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGACAACGCTTACCACCATTCTGCCCCTCGCCCTGCGCGACACCGCGCTCACCGTGACAGAGCTAGCCG
ATGAGGCTGCGCCTGACGACTCCTTCGCAATGTTTCGGAAAAAGTGTCTCGAGCAGGTGACCCGCCTGCG
GGAGGAGTTCCTGGCCGCGGGCCACGCCCCGGCCGTGGTCGAGGATGCCGCCTATGCGCAGTGTGCCTTG
CTGGATGAGTACGCATTGCGTCGGCTCACGGGCGACGAGCGTAGCGCCTGGGAGCGCGAACCATTGCAGG
TCCAAGAGTTCCATAGCCATAACGCGGGCGAAGAGTTGATTGCGCGCATCGAACGCAGGCTGGCGGAAGC
GCAGCCGGTCATTCCCCTGCTGGTTGTCTTTCATGCGGTACTGGGCCTGGGCTTCCAAGGCAAGTTTGCG
TTGGAGGGCAACGCCGCCCGAGAGGCGCTAATGCATGCCATCGATGAACGCCTTCAGCGCGCAGGCGTGC
AGAAGGCCACCGGGCCGGTCATCGTCACTGCCGGCAAGGCGCGGGGATGGCGCGGCCTGTCGCTGTCGCC
GCTGGCCTGGGTGGCCATTGCACTTGTCGGCGCTGGTTTGGTGTATTTTGCGCTGGATCGATGGCTGGCC
GTCTCTATCGCCCGGCTGGCCAGCTAA