SecReT6
Protein ID: 94309567
SecReT6 ID124
T6SS typei2
Gene symbol-
Locus tagRmet_0622
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T6SS(s) in this replicon]
Location [Strand]682966..683796 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ1LQR8
KEGG IDrme:Rmet_0622
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.30E-90, Aligned region: 3..273
Protein Sequence: 276 a.a.     [Download]
>gi|94309567|ref|YP_582777.1| unnamed protein product [Cupriavidus metallidurans CH34]
MRTPQGRFELDPVFVPPCLFLSANDRLTERMRRLSEILAAKSASLAVRRRERSDQIADFAVADVALFWLL
HSVNGTWPELARLCAAPQQHPERLYAVLSRLAGSLLTFSTTETLQAIPAYDHQTPEPMFAELESLIRTLL
DTVIPSRVVPVALEQIRPTVWMGKILDERLVEGAEYYLSVQAGLPAQMLIEQLPRLCKAGAPDEVEQILN
SALPGIPLRTMSRLPAAIPVRIENQYFALDSGHPAFQRMLAARACQFYVPASVPDVSLELFAVLPA
 
Nucleotide Sequence: 831 bp     [Download]
>gi|94308945|ref|NC_007973.1|:c683796-682966 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGCGCACGCCGCAAGGGCGATTCGAACTCGATCCGGTGTTCGTGCCACCGTGCCTCTTCCTGTCAGCGA
ACGACCGGCTCACCGAGCGCATGCGCCGACTCTCGGAAATCCTGGCTGCCAAGAGCGCGAGCCTTGCTGT
GCGCAGGCGTGAGCGTTCCGACCAGATTGCCGATTTTGCAGTCGCCGACGTCGCGCTCTTTTGGCTATTG
CACAGCGTGAACGGAACCTGGCCGGAGTTGGCCCGCCTGTGCGCAGCACCGCAGCAGCATCCGGAACGGC
TCTATGCTGTTCTCTCCCGTCTGGCCGGGTCGCTCCTGACCTTCTCCACCACAGAAACGCTGCAGGCCAT
CCCGGCCTATGACCACCAGACGCCCGAACCAATGTTCGCGGAACTGGAATCGCTGATCCGTACGCTGCTG
GATACGGTAATTCCGTCGCGGGTCGTTCCCGTGGCGCTCGAGCAAATCCGGCCCACGGTCTGGATGGGCA
AGATCCTCGACGAGCGGCTTGTCGAAGGCGCCGAATACTACCTGTCGGTCCAGGCGGGACTGCCCGCCCA
GATGCTGATCGAGCAACTGCCCCGTCTGTGCAAGGCGGGGGCGCCCGACGAGGTCGAACAAATCCTCAAT
TCAGCCTTGCCGGGAATTCCGTTGCGAACCATGTCACGTCTGCCCGCGGCCATTCCGGTTCGGATCGAGA
ACCAGTATTTCGCGCTCGACAGTGGCCATCCAGCATTCCAACGCATGCTGGCTGCGCGGGCCTGCCAGTT
CTATGTCCCTGCCTCGGTACCAGACGTCTCCCTTGAGCTCTTTGCGGTATTGCCAGCATGA