SecReT6
Protein ID: 94309569
SecReT6 ID124
T6SS typei2
Gene symbol-
Locus tagRmet_0624
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T6SS(s) in this replicon]
Location [Strand]684362..685939 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ1LQR6
KEGG IDrme:Rmet_0624
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.80E-179, Aligned region: 91..511
Protein Sequence: 525 a.a.     [Download]
>gi|94309569|ref|YP_582779.1| unnamed protein product [Cupriavidus metallidurans CH34]
MAQHEMSPRANSETDTVVLDAPGKSVYESLCEKINLTPVKATRPMESFQSADALSESSLDERVAQAMTVF
LKMIQDSSQQVDRLDKSLLDFHIAHLDQQISQQLDAIMHHETFQQIESAWRGLKFLVDRTDFRKNVKIEV
LDVSKDALRQDFEDTPELIQSGLYLHTYIQEYDTPGGEPVGSIISNYEFDRSQQDIVLLRNISKVSAAAH
MPFIGSVSPKFFGKDSMDEVASIRDIGNYFDRAEYLKWKSFRDSDDARYIGLTLPRFLARLPYGPDTVPV
RAFNYTEAVKGPDHSRYLWGNASFAFAVNMVQSFIKNGWCVQIRGPQAGGLVEDLPIHLYDLGTGNQAKI
PTEVLIPETREFEFANLGFIPLSYYKNHDFACFFSAHSAQKPALYDTKEATANSRVNARLPYIFLLSRIA
HYLKLIQRENIGTTKDRRVLELELNTWIKTLVTEMTDPGDELQASHPLREAKVIVEDIEDNPGFFRVKLF
IVPHFQIEGMDINLSLVSQMPKAKTDRLLSASTAI
 
Nucleotide Sequence: 1578 bp     [Download]
>gi|94308945|ref|NC_007973.1|:c685939-684362 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGGCCCAGCATGAAATGTCCCCCCGCGCCAACAGCGAAACCGACACCGTCGTCCTGGACGCGCCGGGCA
AGAGCGTCTACGAGTCCCTGTGCGAGAAAATCAACCTGACCCCGGTCAAGGCGACGCGCCCGATGGAGTC
GTTCCAGAGCGCCGATGCACTATCCGAATCGTCGCTGGATGAGCGTGTCGCCCAGGCGATGACCGTGTTC
CTGAAAATGATCCAGGACTCATCGCAACAGGTCGATCGTCTCGACAAGAGCCTGCTCGACTTCCATATCG
CGCATCTGGACCAGCAGATCAGCCAGCAGCTGGACGCGATCATGCACCATGAGACGTTCCAGCAGATCGA
ATCAGCGTGGCGTGGCCTGAAGTTCCTGGTTGACCGGACGGACTTCCGCAAGAACGTCAAGATCGAAGTG
CTGGATGTGTCCAAGGACGCGCTGCGCCAGGATTTCGAGGACACCCCAGAGCTCATCCAGAGCGGGTTGT
ACCTGCACACCTACATTCAGGAGTACGACACACCGGGCGGTGAACCCGTCGGCTCGATCATCTCCAACTA
CGAGTTCGACCGCAGCCAGCAGGATATTGTCTTGCTGCGCAATATCTCCAAGGTGTCCGCCGCCGCCCAT
ATGCCGTTTATCGGCTCGGTGTCGCCAAAGTTCTTTGGCAAGGACTCGATGGACGAGGTAGCCAGCATCC
GCGATATCGGCAATTACTTCGATCGCGCCGAGTATCTGAAGTGGAAGAGCTTCCGCGATTCGGATGACGC
CCGCTATATCGGCCTGACCCTACCGCGCTTCCTCGCGCGCTTGCCCTATGGCCCGGATACGGTACCGGTA
CGCGCCTTCAACTACACCGAAGCCGTCAAGGGGCCGGATCACAGCCGCTATCTGTGGGGCAACGCCTCGT
TCGCCTTTGCCGTGAACATGGTGCAGAGCTTCATCAAGAACGGCTGGTGCGTGCAGATCCGTGGCCCGCA
GGCCGGTGGTCTCGTCGAGGATCTGCCGATCCACCTGTATGACCTGGGCACCGGCAACCAGGCCAAGATC
CCGACCGAGGTGCTGATCCCGGAGACGCGCGAGTTCGAGTTTGCCAATCTCGGCTTCATCCCGCTGTCGT
ACTACAAGAACCACGACTTCGCGTGCTTCTTCTCGGCCCACTCGGCCCAGAAGCCAGCGCTCTACGACAC
CAAGGAGGCCACGGCCAATAGCCGCGTCAATGCACGCCTGCCGTACATTTTCCTGCTGTCACGCATCGCC
CACTACCTGAAGCTGATTCAGCGCGAGAACATCGGTACCACCAAGGATCGGCGCGTGCTGGAGTTGGAGC
TGAACACCTGGATCAAGACGCTCGTCACCGAGATGACAGATCCGGGTGATGAACTTCAGGCCTCGCACCC
GCTGCGCGAAGCCAAGGTAATCGTCGAGGACATCGAAGACAACCCGGGCTTCTTCCGCGTCAAGCTCTTC
ATCGTGCCGCACTTTCAGATCGAAGGGATGGACATCAATCTGTCGCTGGTCTCGCAGATGCCCAAGGCGA
AAACTGATCGACTGCTGTCGGCTTCGACGGCGATTTAG