SecReT6
Protein ID: 94309570
SecReT6 ID124
T6SS typei2
Gene symbol-
Locus tagRmet_0625
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T6SS(s) in this replicon]
Location [Strand]685965..686480 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ1LQR5
KEGG IDrme:Rmet_0625
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.50E-54, Aligned region: 6..158
Protein Sequence: 171 a.a.     [Download]
>gi|94309570|ref|YP_582780.1| unnamed protein product [Cupriavidus metallidurans CH34]
MAESFQNEVPKARVNIKLDLHTGGAQKKVELPLKLLVMGDYSNGQETRALAEREKVSINKNNFNSVLADF
NPKARIAVESTLARDGSELPVDLDFKSMDDFKPEVVASRVPELRALMAARNLLRDLKSNLLDNAMFRREL
EKILKDPGLSERLRADLQKISEAAPASQSAQ
 
Nucleotide Sequence: 516 bp     [Download]
>gi|94308945|ref|NC_007973.1|:c686480-685965 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGGCCGAAAGTTTTCAGAATGAAGTGCCCAAGGCACGGGTCAACATCAAGCTCGACCTGCATACGGGCG
GCGCGCAGAAGAAAGTCGAGCTACCCCTGAAGCTGCTGGTGATGGGCGACTACAGCAACGGCCAGGAAAC
ACGAGCCCTCGCTGAGCGCGAGAAGGTGTCGATCAACAAGAACAACTTCAATTCCGTCCTCGCCGACTTC
AACCCGAAGGCTCGGATCGCGGTCGAGAGCACCCTCGCACGGGATGGATCGGAGCTGCCGGTCGATCTCG
ACTTCAAGTCCATGGATGACTTCAAGCCGGAAGTGGTCGCGAGCCGCGTGCCCGAGCTGCGGGCCCTGAT
GGCCGCACGCAACCTGCTGCGCGACCTCAAGTCGAATCTGCTCGACAACGCCATGTTTCGTCGCGAGCTC
GAAAAGATCCTTAAGGACCCTGGTCTGTCCGAGCGCCTGCGGGCCGATCTGCAGAAGATCAGCGAGGCTG
CACCGGCCTCCCAGTCTGCCCAGTAA