SecReT6
Protein ID: 94309571
SecReT6 ID124
T6SS typei2
Gene symbol-
Locus tagRmet_0626
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T6SS(s) in this replicon]
Location [Strand]686770..689439 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ1LQR4
KEGG IDrme:Rmet_0626
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-49, Aligned region: 52..351
DUF2345 [PF10106], Evalue: 1.10E-48, Aligned region: 604..757
T6SS_Vgr [PF13296], Evalue: 1.30E-36, Aligned region: 484..590
Phage_base_V [PF04717], Evalue: 1.10E-11, Aligned region: 401..477
Sarcoglycan_1 [PF04790], Evalue: 0.0019, Aligned region: 680..749
Protein Sequence: 889 a.a.     [Download]
>gi|94309571|ref|YP_582781.1| unnamed protein product [Cupriavidus metallidurans CH34]
MAGELDGLKAYGAEALRNAVAVTVTGRQAYFLEVPGSASAAGLSVVSFEAVERLGEPYEVRVRLTHPLEL
GRAEYLNRDATFVIDAGEDSEPRKFAGWVSGFSKTRQTRDFCAYEMVVVPQVARLRLTKRSRIYQQKTAP
QIIEAILRGHELKGHQFAFKTRRTYPQLAFRMQYEMSDWDYIRLLMEQEGLYCYFTPGKFGEMVVFGDDI
DHYIYQPELRVPYRETAGLESGLEAVYEIQTHAITVPASVKVADYNSADSWERKVAEANIAYKDKTTYGQ
PYVYGTHHLDQAGAKWQAQLRHEAAIAWQLTYAGQSNVLALRPARILRIDTTLPDAPNGQVITEVIHTGA
RDQAYRNTYKAIPCDRRFRLPMDESKWPRIAGALSGRITSPGQYKYAYLTQDGHYIVRFDFDFDEWPKGG
ESVPLRLAKPFAGALQTGFHFPLIDGTEVAIAFHDGNPNKPFISAALHASLQPDHITNQDRWMSRNVFRT
QANNKLRFEDWQGQESVKLSTEYGGKTQLNLGYLVDHKKKKRGEGFELRTSGWGAIRGGKGLFLSADDQP
GANGQHLDMQSALWLLEQALQQSEALADTAKAAQAMAADCERQKTLLNASLKQLKAASLLASAPAGMALV
SGTDLQLSAANNMIATAGGNADISVLRQFAVAAGNGISLFVQKLGIKLFAAKGKVEIQAQSDELNLTALK
DLKVISVDGKLILSAKTEVWIGVGGSYIRITPERIENGTPGDIYEKCAAWDKKGAASMQVSTALNSGLPK
QLLMLNTAASPASSNTLPAGMPYKLLAGGAVVKQGVMDGTGFIPVDHLPTTQAYQLELANGAKYTLPVAD
DYRGDAANGELANQGIHFHEAAHGSDGAAADRAAHRRAYHETFNPESEA
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|94308945|ref|NC_007973.1|:686770-689439 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGGCGGGTGAGTTGGATGGACTGAAGGCGTACGGAGCGGAGGCGCTGCGTAATGCGGTGGCCGTGACGG
TTACCGGGCGGCAGGCGTACTTCCTCGAGGTGCCAGGGTCCGCCAGCGCCGCTGGGTTGTCAGTGGTGTC
TTTCGAGGCAGTGGAGCGCCTGGGCGAGCCCTATGAAGTCCGGGTACGCCTGACACATCCGCTGGAGTTG
GGCCGGGCTGAGTACCTGAACCGGGACGCCACCTTCGTCATCGATGCGGGCGAGGACAGTGAGCCGCGCA
AGTTCGCGGGCTGGGTTTCAGGGTTCTCGAAGACCCGCCAGACCCGTGACTTCTGCGCGTACGAGATGGT
CGTGGTGCCGCAGGTCGCGCGGCTGAGGCTGACGAAGCGCAGCCGCATTTACCAGCAGAAGACTGCCCCA
CAGATTATCGAGGCCATCCTGCGTGGCCATGAGTTGAAGGGGCATCAGTTCGCTTTCAAGACCCGGCGCA
CCTATCCGCAGCTCGCCTTTCGCATGCAGTACGAGATGTCCGATTGGGACTACATCCGGCTGCTGATGGA
ACAGGAAGGGTTGTACTGCTATTTCACGCCGGGCAAGTTCGGCGAGATGGTGGTGTTCGGGGACGACATC
GATCACTACATCTACCAGCCCGAGCTGCGTGTGCCCTACCGCGAAACAGCAGGCCTTGAGTCGGGCCTGG
AAGCGGTCTACGAAATCCAGACGCACGCAATAACGGTGCCGGCGTCGGTCAAGGTGGCGGACTACAACTC
GGCTGATTCGTGGGAACGAAAAGTGGCCGAGGCCAACATCGCCTACAAGGACAAGACGACCTACGGCCAG
CCCTACGTCTACGGCACGCATCACCTGGACCAGGCCGGCGCGAAATGGCAAGCGCAACTGCGGCACGAAG
CGGCTATCGCTTGGCAGCTGACCTACGCGGGTCAAAGTAACGTGCTGGCATTGCGTCCGGCGCGCATTTT
GCGCATCGACACGACCTTGCCGGACGCGCCCAATGGGCAGGTCATCACTGAAGTCATCCACACCGGCGCC
CGCGATCAAGCGTACCGCAATACCTACAAGGCCATTCCTTGCGACCGGCGCTTCCGCCTGCCGATGGACG
AGTCAAAATGGCCGCGCATTGCCGGAGCGCTCAGTGGCCGGATCACGTCGCCAGGCCAGTACAAGTATGC
GTACCTGACGCAGGACGGGCACTACATCGTCCGGTTCGACTTCGACTTTGACGAGTGGCCCAAGGGCGGC
GAGAGCGTGCCGCTGCGCCTCGCCAAGCCGTTTGCCGGGGCATTGCAGACAGGATTTCACTTTCCGCTGA
TTGACGGTACCGAGGTGGCGATTGCCTTCCATGACGGGAATCCCAACAAGCCCTTTATTAGTGCCGCATT
ACACGCAAGCCTGCAGCCCGATCACATCACCAATCAGGACCGGTGGATGTCACGCAACGTCTTCCGCACG
CAGGCCAATAACAAGCTGCGCTTCGAGGATTGGCAGGGGCAGGAGAGCGTCAAGCTATCCACGGAGTACG
GTGGCAAGACCCAGTTGAACCTCGGCTACTTGGTCGATCACAAGAAGAAAAAGCGTGGGGAAGGGTTCGA
GTTGCGAACCTCAGGTTGGGGCGCGATCCGGGGTGGCAAGGGGCTGTTCCTGTCGGCGGATGATCAGCCG
GGCGCGAACGGGCAGCACCTGGACATGCAGTCTGCATTGTGGTTGCTGGAGCAGGCGCTGCAGCAAAGTG
AAGCGTTGGCGGACACTGCCAAGGCAGCCCAGGCGATGGCGGCGGACTGCGAGCGGCAGAAGACACTGCT
CAATGCCTCGCTGAAGCAACTGAAAGCGGCAAGCCTGCTTGCAAGTGCGCCCGCTGGCATGGCGCTGGTG
TCCGGTACAGACCTGCAACTCAGTGCTGCCAACAACATGATCGCGACGGCAGGCGGCAATGCCGACATCA
GCGTTCTGCGTCAATTTGCGGTGGCCGCAGGCAATGGGATATCTCTTTTTGTGCAGAAGCTCGGGATAAA
GCTCTTTGCGGCCAAAGGCAAGGTCGAAATCCAGGCGCAGAGCGACGAGTTGAACCTGACGGCGCTGAAG
GACCTGAAAGTCATCAGTGTCGATGGCAAGCTGATTCTTTCGGCCAAGACAGAAGTATGGATTGGCGTAG
GGGGCTCCTACATTCGCATCACGCCGGAGCGCATCGAGAACGGTACGCCGGGCGATATCTACGAGAAGTG
CGCAGCGTGGGATAAGAAAGGCGCGGCATCCATGCAGGTTTCGACGGCGCTCAACAGCGGGCTACCAAAG
CAGCTTCTGATGCTCAATACCGCAGCCTCACCGGCGTCCAGCAATACGCTGCCGGCCGGGATGCCGTACA
AGCTGCTGGCGGGGGGCGCGGTGGTCAAGCAAGGCGTGATGGATGGAACTGGCTTCATCCCCGTGGATCA
CCTGCCCACCACTCAGGCGTACCAACTGGAGCTTGCCAACGGTGCCAAGTACACGTTGCCGGTTGCGGAC
GATTATCGGGGCGATGCCGCGAACGGCGAGCTGGCGAATCAAGGCATTCATTTTCACGAGGCCGCGCACG
GCAGCGACGGTGCTGCAGCTGACCGGGCAGCCCATCGGCGGGCTTACCACGAGACGTTCAATCCGGAATC
GGAAGCATGA