SecReT6
Protein ID: 94309579
SecReT6 ID124
T6SS typei2
Gene symbol-
Locus tagRmet_0634
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T6SS(s) in this replicon]
Location [Strand]699369..700940 [+]
ProductImpA, N-terminal
NoteTssA
UniProt IDQ1LQQ6
KEGG IDrme:Rmet_0634
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.90E-18, Aligned region: 65..123
Protein Sequence: 523 a.a.     [Download]
>gi|94309579|ref|YP_582789.1| unnamed protein product [Cupriavidus metallidurans CH34]
MFNNLFNALFGARAPADLARSTLARWEPLLQPIRQEALVGDDPGYEDDFLAIKEEVAKRSDINDALIVES
AERLLKTSAKDVRLAVYYIYGRMRRDGAEGIADGFELLAALIDRFGPKLLPARAESQKAALEWLAGATFT
DRLDRVQGFAGGPLERTLSAMALILEGIGKWPEPARPALEALFRWFEERVETPSSAEGKGNIAAPKALAT
ASLLGGEVTSTRDLLDRARQMALFLRQQPDGYLAAYRLMRCVRWDTLTEAPPHEASGRTRLVAPRAELRA
QIKRLMLQKQWPELLDRIEPAFAEGANHFWLDLQYYAFMAQDHAGGAYARVRDLLATDCALMLERLPGLD
QLAFSDGTPFADDATLEWIARYATVRDIERGESVSPVAVASVSADLAETEAQAIDLAAQQSLEAAFAWLQ
GLPAPAGERDRFVRQLVMARVAERVDRADTALHLLSALETGTQRYQLANWEPSLAFEVKQHLLRLLRVRL
TRKDADKAALSGRIEALVGDLTAIDPARAVAIT
 
Nucleotide Sequence: 1572 bp     [Download]
>gi|94308945|ref|NC_007973.1|:699369-700940 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGTTCAATAACCTGTTCAACGCGCTGTTCGGCGCGCGCGCCCCCGCCGATCTGGCCCGCTCCACGCTGG
CCCGGTGGGAGCCATTGTTGCAGCCGATCCGTCAGGAGGCACTGGTCGGAGACGACCCGGGTTACGAGGA
TGACTTCCTCGCCATTAAGGAGGAAGTGGCCAAGCGCTCGGATATCAATGATGCCTTGATCGTGGAGTCG
GCCGAGCGCTTGCTCAAGACCAGCGCCAAGGATGTCCGCCTGGCGGTTTACTACATCTATGGCCGTATGA
GACGCGACGGTGCGGAAGGGATCGCCGACGGCTTCGAACTACTGGCGGCACTGATCGATCGCTTCGGCCC
CAAGTTGCTACCAGCCCGCGCGGAAAGCCAAAAGGCCGCACTCGAATGGCTGGCCGGTGCCACCTTCACC
GATCGGCTTGACCGGGTGCAGGGATTCGCCGGTGGCCCGCTGGAGCGCACGCTGTCGGCGATGGCGCTGA
TTCTGGAGGGCATCGGAAAGTGGCCCGAGCCGGCCCGTCCGGCGCTCGAAGCGCTGTTTCGCTGGTTCGA
GGAACGGGTCGAAACGCCGTCGTCAGCGGAAGGTAAGGGGAACATCGCTGCTCCGAAAGCCCTTGCCACG
GCGTCGCTCTTGGGCGGAGAGGTGACCTCCACGCGCGACCTGCTGGATCGGGCGCGCCAGATGGCATTGT
TCCTGCGCCAGCAGCCTGACGGCTATCTCGCCGCCTATCGGCTGATGCGCTGCGTGCGTTGGGACACCCT
TACCGAGGCGCCGCCGCATGAAGCCAGCGGCAGGACCCGCCTGGTAGCCCCGCGCGCCGAACTACGCGCG
CAAATCAAGCGGCTGATGCTGCAAAAACAGTGGCCGGAGTTGCTCGACCGAATCGAACCGGCCTTCGCCG
AGGGCGCCAATCATTTCTGGCTGGACCTGCAGTACTACGCGTTCATGGCGCAGGACCATGCCGGTGGCGC
CTACGCGCGCGTGCGCGACCTGTTGGCCACCGACTGCGCCCTGATGCTGGAACGTCTGCCGGGCCTGGAC
CAGCTTGCCTTCTCGGACGGCACGCCGTTTGCGGACGACGCCACGCTCGAATGGATTGCGCGCTACGCCA
CCGTGCGGGATATCGAGCGCGGCGAATCCGTGTCGCCGGTTGCGGTTGCCTCCGTGAGTGCCGACTTGGC
GGAAACGGAAGCGCAGGCGATCGACCTCGCCGCACAGCAGAGTCTGGAGGCTGCCTTTGCCTGGCTGCAG
GGGTTGCCGGCACCGGCTGGCGAGCGCGATCGCTTCGTGCGGCAACTGGTGATGGCGCGTGTGGCCGAGC
GCGTCGACCGGGCCGATACCGCCTTGCACTTGCTGTCCGCGCTCGAAACCGGCACCCAGCGCTATCAACT
GGCCAACTGGGAGCCCTCCCTCGCGTTCGAGGTCAAGCAGCATCTGCTGCGCCTGCTGAGGGTGCGCCTC
ACCCGCAAGGACGCGGACAAGGCAGCCCTGAGCGGGCGCATCGAGGCGCTGGTCGGCGACCTGACCGCCA
TCGATCCTGCCCGCGCCGTGGCCATCACCTAA