SecReT6
Protein ID: 94309580
SecReT6 ID124
T6SS typei2
Gene symbol-
Locus tagRmet_0635
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T6SS(s) in this replicon]
Location [Strand]700962..702782 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ1LQQ5
KEGG IDrme:Rmet_0635
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-184, Aligned region: 11..604
Protein Sequence: 606 a.a.     [Download]
>gi|94309580|ref|YP_582790.1| unnamed protein product [Cupriavidus metallidurans CH34]
MNHPAQDNEILRYYEAEMRYLREAGKEFAQAFPDRARMLNIDRIGERDPHVERLFEGFAFLMGRLRHKLD
DELPELTEGLVSMLWPHYLRMIPSLSILELSPNVGALQRHETLPAGLEVVSDPIALATQDGIEGSVECIY
RTTQPVDLYPLRLTEANAYAREDGRSVIRLRLALQTQGRREQLAVPRLRLYLHADRPLALALYSALTAKP
LAMQVRVPGYPADRPGAPQPMAGIRLEPAGFAAEERLWPKADNAFGGYQLLLEYFTFPEKFMFVDLVGLD
LDAIPEGVEHFDVEVVLNRPFPDDMRFSADNVRLFCTPIINLFELEADPITITHFETEYRVRAMEQHGQH
VEPYSVETVRGFETGSGKRFEYAPFAAFRHRGGMLRHEMPERYFHTRVRRGPSGRFDTWVVLGGHAWDHQ
QFLPEETLSLSVTGTNGMLPRKGLREAGITRTSGGFTHIGTVRNLTAPTMPVYPPSGDRFHWRVLSHLAP
NYLSLLDAEVLRGSLALYDWTDGELNRRRIEAITDVRHRPLQKLVKGGLLRGVEIEVVLDSTRFAGEGDV
ELFGEMLNRFLSLYATVNLYTRLVIVSQPSGKHQVWPDSKGEGAPF
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|94308945|ref|NC_007973.1|:700962-702782 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAACCATCCCGCCCAAGACAACGAGATCCTGCGTTACTACGAAGCCGAGATGCGCTACCTGCGCGAAG
CCGGCAAGGAGTTCGCACAGGCGTTCCCTGACCGCGCCCGTATGCTCAACATCGACCGTATCGGCGAGCG
GGACCCTCACGTCGAACGGCTGTTCGAGGGCTTCGCATTCCTGATGGGGCGGCTGCGCCATAAGCTGGAC
GATGAGTTGCCGGAACTGACCGAGGGCCTGGTCAGCATGCTGTGGCCGCATTACCTGCGCATGATCCCGT
CATTGTCGATCCTGGAACTGTCCCCGAACGTTGGAGCGCTGCAGCGCCATGAAACGCTGCCGGCCGGACT
GGAGGTGGTCTCCGATCCCATTGCGCTCGCCACACAAGACGGGATTGAAGGGAGTGTCGAATGCATTTAC
CGGACCACGCAACCAGTCGATCTATACCCGTTGCGCCTTACTGAAGCCAATGCCTATGCGCGCGAGGATG
GCCGCTCGGTCATCCGGCTGCGGCTGGCACTACAAACTCAGGGGCGCCGCGAGCAGTTGGCGGTGCCGCG
CCTGCGGCTCTACCTGCATGCCGATCGCCCGCTGGCGTTGGCGCTTTACTCAGCGCTCACCGCTAAGCCA
TTGGCCATGCAAGTGCGGGTACCGGGCTATCCGGCCGACCGGCCCGGCGCACCCCAGCCGATGGCAGGGA
TACGGTTGGAGCCAGCCGGATTCGCTGCCGAGGAACGCCTGTGGCCGAAGGCTGACAACGCCTTCGGCGG
CTACCAACTGTTGCTGGAGTACTTCACCTTCCCCGAGAAGTTCATGTTCGTGGATCTCGTGGGGCTCGAT
CTGGACGCCATCCCGGAAGGCGTCGAGCACTTTGATGTGGAGGTGGTACTCAATCGGCCGTTCCCGGATG
ACATGCGCTTCTCGGCCGATAACGTGCGCCTCTTTTGCACGCCGATCATCAACCTGTTCGAGCTGGAAGC
CGACCCGATCACCATCACCCACTTCGAGACCGAGTACCGCGTGCGGGCCATGGAGCAGCATGGACAACAT
GTGGAACCCTATTCGGTGGAAACCGTACGGGGATTCGAGACGGGCAGTGGCAAGCGCTTCGAGTACGCGC
CTTTCGCCGCGTTCCGCCATCGGGGCGGCATGCTGCGTCATGAGATGCCGGAGCGCTATTTCCACACCCG
CGTGCGCCGCGGTCCTTCGGGGAGGTTCGACACTTGGGTTGTGCTGGGAGGGCACGCCTGGGATCATCAG
CAGTTCCTGCCCGAGGAGACGTTGTCGCTGTCGGTCACCGGCACCAACGGCATGCTGCCGCGCAAGGGCT
TGCGCGAGGCAGGCATCACCCGCACGAGCGGGGGATTCACGCACATTGGCACCGTACGCAATTTGACCGC
GCCGACGATGCCCGTGTATCCGCCCTCCGGCGATCGCTTCCATTGGCGCGTGCTATCGCACCTGGCGCCC
AACTACCTGTCGCTGCTCGACGCCGAAGTTCTGCGCGGCAGCCTGGCGCTGTACGACTGGACCGATGGGG
AACTGAACCGTCGGCGTATCGAGGCCATCACAGACGTGCGGCACCGCCCGCTCCAGAAGCTCGTCAAAGG
CGGCCTGTTGCGCGGCGTGGAGATCGAAGTGGTGCTGGATAGCACGCGCTTCGCCGGCGAAGGCGATGTG
GAACTCTTTGGCGAGATGCTCAACCGCTTCCTGTCGCTGTACGCTACCGTCAATCTCTATACGCGCCTGG
TGATCGTGTCGCAGCCTAGCGGCAAGCACCAGGTGTGGCCCGACAGCAAAGGGGAGGGGGCTCCGTTTTG
A