SecReT6
Protein ID: 94309581
SecReT6 ID124
T6SS typei2
Gene symbol-
Locus tagRmet_0636
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T6SS(s) in this replicon]
Location [Strand]702800..703888 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ1LQQ4
KEGG IDrme:Rmet_0636
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.90E-87, Aligned region: 15..322
Protein Sequence: 362 a.a.     [Download]
>gi|94309581|ref|YP_582791.1| unnamed protein product [Cupriavidus metallidurans CH34]
MSPPKEGPLLRALLANAPQMNFFRLCELIELSVPQRPPLGTTDSLADDPVRFRSNGGLGFPGREIDLVDY
DDDYPDRPPVIRTAFLGLYGVDARMPSYFVDEIAQRRDGAESLAAFLDLFHHRVVTQFYRVARKYRYPMG
FLSGGPDEVSRYLLSLLGLGLREPGAGRPGVEHVEHVEGAVSPRKLLSMLGLASQRTRTAEGLAGVLQHA
VPDAQILVEEFYPVWVRLDATERMPLGENCVLGRGFYDRANAVRVVITPQTPESVLGLMPGRAMHREVMV
LLRFYLGHAAHAHLEMQVRPALMPAPALNSNAVSLGYSTQLQCSVATTNANATRGAAITRVQLGTWNGFN
AGASAPLSHRSQ
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|94308945|ref|NC_007973.1|:702800-703888 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGTCACCCCCGAAGGAAGGTCCCTTGTTGCGAGCGTTGCTCGCCAATGCACCTCAGATGAATTTCTTCC
GACTGTGTGAACTGATCGAGCTGTCCGTGCCGCAGCGCCCGCCGCTGGGCACCACGGATTCCCTGGCCGA
CGACCCAGTGCGCTTCCGTTCCAATGGGGGGCTTGGGTTCCCGGGGCGGGAGATCGATTTGGTCGACTAC
GACGATGACTACCCAGACCGGCCACCAGTCATTCGCACAGCCTTCCTTGGCCTGTATGGCGTCGACGCGC
GTATGCCGTCCTACTTCGTGGACGAGATTGCTCAGCGTCGTGATGGCGCAGAGTCGCTGGCGGCCTTCCT
GGACCTGTTTCACCACCGCGTTGTCACGCAGTTCTACCGGGTCGCGCGCAAGTATCGCTATCCGATGGGT
TTCCTGTCGGGCGGACCGGACGAGGTTTCACGCTACCTGCTCAGTCTGCTCGGGCTGGGGCTGCGCGAGC
CGGGAGCCGGGCGGCCCGGTGTCGAACACGTCGAACACGTCGAAGGCGCCGTCAGCCCGCGCAAACTGTT
GTCGATGCTGGGACTGGCCAGCCAGCGCACACGGACTGCTGAGGGTCTTGCCGGCGTGTTGCAGCATGCC
GTGCCGGATGCGCAGATCCTGGTGGAGGAGTTCTACCCCGTGTGGGTGCGCCTCGATGCCACCGAGCGCA
TGCCACTCGGCGAGAACTGTGTGTTGGGGCGAGGCTTCTACGACCGTGCCAATGCGGTACGCGTGGTGAT
CACGCCCCAGACGCCCGAATCGGTGCTTGGGCTGATGCCGGGTCGGGCCATGCACCGGGAGGTGATGGTG
CTGTTGCGCTTCTACCTCGGCCATGCCGCGCACGCGCATCTGGAGATGCAGGTGCGGCCAGCGCTGATGC
CGGCTCCGGCCCTGAACTCGAATGCGGTGAGTCTTGGGTATAGCACGCAACTCCAGTGCTCCGTGGCCAC
CACCAACGCCAACGCGACCCGGGGAGCCGCGATCACGCGCGTGCAGTTGGGAACATGGAATGGATTCAAT
GCCGGAGCATCCGCGCCTCTAAGCCATCGCAGTCAATGA