SecReT6
Adaptor Protein ID: 15595292
SecReT6 ID3
T6SS typeA3
Gene symbol-
Locus tagPA0094
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]114611..115045 [-]
Producthypothetical protein
Adaptor typeProtein
Homologous adaptorPA0094
DescriptionEagT6,a Tse6 specific chaperone.
UniProt IDQ9I738
KEGG IDpae:PA0094
PDB ID1TU1
Domain hit(s) vs Pfam DcrB [PF08786], Evalue: 2.0e-34, Aligned region: 8-136
Relates to structure protein
Chaperone of effectorTse6 (PA0093)
Protein Sequence: 144 a.a.     [Download]
>gi|15595292|ref|NP_248784.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MTLYRLHEADLEIPDAWQDQSINIFKLPASGPAREASFVISRDASQGDAPFADYVARQLENAEKQLPGFK
LHKRWDINIHGHAAVLLDYQWQREGRDLMLRQVFIERRPAVLITTLTTTPADLPHHEPAWKQAMQTLVPR
PTPS
-
Nucleotide Sequence: 435 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c115045-114611 Pseudomonas aeruginosa PAO1 chromosome, complete genome
GTGACGCTCTATCGCCTCCACGAAGCCGATCTCGAGATTCCCGATGCCTGGCAGGACCAGAGCATCAACA
TCTTCAAGCTCCCCGCCAGCGGCCCCGCCCGCGAAGCCAGTTTCGTCATCAGCCGTGACGCCAGCCAGGG
CGACGCGCCGTTCGCCGACTATGTCGCCCGCCAACTGGAAAACGCCGAGAAGCAATTGCCCGGCTTCAAG
CTGCACAAGCGCTGGGACATCAACATCCACGGCCACGCCGCCGTGCTCCTCGACTACCAGTGGCAGCGCG
AGGGCCGCGACCTGATGCTGCGCCAGGTATTCATCGAGCGCCGCCCGGCGGTGCTGATCACCACCCTGAC
CACCACCCCGGCTGACCTGCCGCACCACGAGCCGGCCTGGAAGCAGGCGATGCAGACCCTGGTCCCGCGC
CCGACCCCTAGCTGA

Reference
(1) Whitney JC, Quentin D, Sawai S, LeRoux M, Harding BN, Ledvina HE, Tran BQ, Robinson H, Goo YA, Goodlett DR, Raunser S, Mougous JD (2015). An interbacterial NAD(P)(+) glycohydrolase toxin requires elongation factor Tu for delivery to target cells. Cell. 163(3):607-19. [PudMed:26456113] experimental
 
experimental experimental literature