SecReT6
Adaptor Protein ID: 15595456
SecReT6 ID4
T6SS typeA1
Gene symbol-
Locus tagPA0259
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]289562..291004 [-]
Producthypothetical protein
Adaptor typeProtein
Homologous adaptorPA0259
DescriptionTla3 is appropriate with a recruiting role of Tle3 to the H2-T6SS machinery through an interaction with the TTR domain of VgrG2b.
UniProt IDQ9I6N0
KEGG IDpae:PA0259
PDB IDNA
Domain hit(s) vs Pfam DUF2875 [PF11394], Evalue: 1.8e-11, Aligned region: 10-252
DUF2875 [PF11394], Evalue: 3.0e-30, Aligned region: 243-422
Relates to structure proteinVgrG2b (PAO0262)
Chaperone of effectorTle3 (PA0260)
Protein Sequence: 480 a.a.     [Download]
>gi|15595456|ref|NP_248950.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MSADAYHPPTTSPRLETLDVLSIGMSLDVFRQGQVWKALQEQNAAQAEALHVGSILPMDPKKYPTSADDK
DMAYEKRQADALELGLKNFLEKWPIPTVTVVRGWDPSTPNLRFTPEETRESLSVKVNDLRVPAGLHWHRI
ANLQDGIICNDTPEGVLEALFSLFERNPDLPAVLVYANEGISMAGALSSRDVTLKSLGAVSGPRIPGTLT
DAMVALIVGRPERVDWLRQFAPYTKVNENRIDPEFRGWGWRKPPVEFRPTPFIPQPWTERALEQWDALPV
LARLHRPVSVPLTHPDTGERLKREALTAQLAAAWKTASAGLRPAPARLFYDGGLNATPLAELTPALGAAQ
SSLDLLDSRESYDLTQRLGDTGAASPFVGITLATMASYLNGDSSMVMPLRRKDQATLIGISSPTPGKKPV
HDPFGVDLLPQTASGDGPPPSADPVAPASRLTTRLPPGEDYALEEFLSSLKPSTDWQDDL
-
Nucleotide Sequence: 1443 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c291004-289562 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGTCCGCTGATGCTTATCACCCACCGACAACTTCGCCGCGCCTGGAAACCCTGGACGTGCTCAGCATAG
GCATGAGCCTGGATGTGTTTCGCCAGGGGCAAGTGTGGAAGGCCTTGCAGGAGCAGAATGCCGCACAGGC
CGAGGCGTTGCATGTCGGCAGCATCCTGCCGATGGACCCGAAGAAGTATCCGACGTCTGCGGATGACAAG
GATATGGCGTATGAAAAGCGCCAAGCGGACGCCTTGGAACTAGGGCTGAAAAACTTCCTGGAGAAATGGC
CGATACCGACGGTGACGGTGGTGCGTGGTTGGGATCCGAGCACTCCTAACCTACGCTTCACTCCGGAGGA
GACGCGGGAAAGCCTGTCAGTAAAAGTCAATGATCTCCGTGTTCCGGCTGGACTGCATTGGCATCGGATT
GCCAATTTGCAGGATGGCATTATCTGTAACGATACGCCTGAAGGAGTACTGGAGGCGTTGTTCAGTTTAT
TCGAACGCAACCCTGACTTGCCAGCAGTGTTGGTGTATGCGAATGAAGGCATCAGTATGGCGGGGGCGCT
TTCCAGTAGAGATGTAACATTGAAGTCACTAGGCGCTGTGTCAGGCCCTCGGATACCTGGAACGCTTACG
GATGCAATGGTCGCCCTGATCGTCGGCCGCCCCGAGCGGGTCGACTGGCTACGCCAGTTCGCCCCCTACA
CCAAGGTCAACGAAAACCGGATCGACCCCGAGTTCCGTGGCTGGGGCTGGCGCAAGCCGCCGGTGGAGTT
CCGCCCCACGCCGTTCATTCCCCAGCCCTGGACCGAGCGGGCTCTGGAGCAGTGGGATGCGTTGCCGGTG
CTGGCCAGGCTGCATCGGCCGGTGAGTGTGCCGCTGACCCACCCGGATACCGGCGAACGGCTCAAGCGCG
AAGCTCTCACCGCACAACTGGCCGCTGCCTGGAAGACGGCCAGTGCCGGGCTCAGGCCGGCGCCCGCCCG
GCTGTTCTACGACGGCGGTTTGAACGCCACGCCGCTGGCCGAACTCACCCCGGCGCTGGGCGCCGCGCAG
AGTTCGCTGGACTTGCTGGACTCGCGGGAAAGCTACGACCTGACCCAGCGCCTGGGCGACACCGGCGCGG
CCTCGCCCTTCGTTGGCATCACCCTGGCGACCATGGCCAGCTACCTCAACGGCGACAGCAGCATGGTGAT
GCCGTTGCGGCGCAAGGACCAGGCGACCCTGATCGGCATCAGCTCGCCGACGCCGGGGAAGAAGCCCGTT
CACGACCCGTTCGGCGTCGACCTGCTGCCGCAGACCGCCAGCGGCGACGGTCCGCCGCCATCGGCCGACC
CGGTGGCGCCCGCCAGTCGGCTCACGACCCGGTTGCCGCCCGGCGAAGACTATGCCCTGGAAGAGTTCCT
GAGCAGCCTCAAACCCAGCACCGACTGGCAGGACGATTTATAG

Reference
(1) Berni B, Soscia C, Djermoun S, Ize B, Bleves S (2019). A Type VI Secretion System Trans-Kingdom Effector Is Required for the Delivery of a Novel Antibacterial Toxin in Pseudomonas aeruginosa. Front Microbiol. 10:1218. [PudMed:31231326] experimental
 
experimental experimental literature