SecReT6
Adaptor Protein ID: 50085751
SecReT6 ID61
T6SS typeA4b
Gene symbol-
Locus tagACIAD2685
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]2641820..2643250 [-]
Producthypothetical protein
Adaptor typeProtein
Homologous adaptorACIAD2685
Descriptionstrongly reduced frequency of T6SS assembly observed by fluorescence microscopy.
UniProt IDQ6F926
KEGG IDaci:ACIAD2685
PDB IDNA
Domain hit(s) vs Pfam NA
Relates to structure protein
Chaperone of effector
Protein Sequence: 476 a.a.     [Download]
>gi|50085751|ref|YP_047261.1| hypothetical protein ACIAD2685 [Acinetobacter sp. ADP1]
MLFADRSRSMIKKIISVLVLVLVVVTSVMIVYWKDSQFDPSAQDIWLYLVILPLVLGSVLLAPWLLFKAY
RAYRQRQQELAIQKEITPEKSEIASETTPEWITLNVFSSYAFATAGENNELLDAIMDYQSPQLDTELVNA
YGLPILSYRITDLTLEQNETEYSARQQRIRALITQQIQQQHMTLLNIAEHLKHSSLFYETEHVQAYRMHP
AWINEQYTDQEEDSSQTAPEPVSQLTRLNVHIFLPEDLLHFWNDDENNDFLNQQLIQLGFIPEKIFIEYQ
FVSAVSAYTEWNELLKRIAIKTDEVTLVVSVDSEIDQELIEERFWQHQNYIPSEFIASCCLAAESVLINS
LQPLKQLKLCTNHSDTALALNHLQLHDLPQYQDEQPFVFILEQAADFGMSKSLDQHFNRTSIEPHHYLYA
CSLIGHTQQVSKIYGAMLALQTIDQSVAFIFSRHALSTFTVVQNAISEIEQEEEAA
-
Nucleotide Sequence: 1431 bp     [Download]
>gi|50083297|ref|NC_005966.1|:c2643250-2641820 Acinetobacter sp. ADP1 chromosome, complete genome
GTGTTATTCGCTGATAGGAGCCGTAGCATGATTAAAAAGATTATATCTGTTCTGGTACTGGTTTTGGTAG
TGGTCACCAGTGTCATGATTGTGTATTGGAAAGATAGCCAGTTTGATCCAAGTGCTCAAGATATCTGGCT
TTATTTGGTGATACTACCACTGGTTCTTGGCAGTGTTTTACTGGCACCATGGTTGTTGTTTAAAGCATAT
CGTGCTTATCGGCAACGTCAGCAAGAGCTTGCTATACAAAAAGAAATAACGCCTGAAAAGTCTGAAATAG
CATCTGAAACTACGCCTGAGTGGATTACACTTAACGTTTTTTCGAGTTATGCCTTTGCAACTGCTGGAGA
GAATAACGAGCTTCTGGACGCAATAATGGACTATCAAAGTCCACAGTTGGATACCGAACTGGTCAACGCA
TATGGTCTTCCAATCTTGTCATATCGGATTACAGATTTAACCCTAGAACAAAACGAAACCGAGTATTCAG
CGCGTCAGCAACGAATCCGTGCGTTGATAACTCAACAAATCCAACAACAACACATGACCTTATTAAACAT
TGCAGAGCATTTAAAGCATTCTAGCTTGTTTTATGAGACAGAACATGTACAGGCTTATCGGATGCATCCC
GCCTGGATCAATGAGCAATATACTGATCAAGAAGAAGATTCCTCTCAAACTGCTCCAGAACCAGTTTCAC
AACTAACACGTTTGAATGTACACATTTTTTTACCAGAAGATTTGCTGCATTTTTGGAATGATGATGAAAA
TAATGATTTCCTAAATCAGCAACTTATACAGCTAGGTTTTATTCCAGAAAAAATATTCATTGAATATCAA
TTTGTCAGTGCTGTGTCTGCTTATACTGAATGGAACGAGCTATTAAAGCGTATTGCGATAAAAACAGATG
AAGTGACTTTAGTTGTTTCAGTCGATTCTGAAATTGATCAGGAGCTGATTGAAGAACGATTCTGGCAACA
TCAGAATTATATTCCATCAGAATTTATTGCCAGTTGTTGTCTAGCTGCTGAATCAGTATTGATAAATTCA
CTGCAACCCTTAAAACAGTTAAAACTCTGCACCAATCATTCAGATACTGCTTTGGCATTAAACCATCTGC
AATTGCATGATTTGCCACAATATCAAGATGAGCAGCCTTTTGTTTTTATTCTTGAACAAGCGGCCGATTT
CGGGATGTCGAAATCACTTGATCAGCATTTTAATCGAACCTCCATCGAGCCACATCATTATCTATATGCA
TGTTCGCTAATTGGACATACTCAGCAGGTCAGTAAAATTTATGGTGCAATGCTGGCTTTGCAAACGATAG
ATCAATCTGTTGCATTTATTTTTAGTCGTCACGCGCTTTCGACATTCACTGTTGTTCAGAATGCAATCTC
GGAAATAGAGCAAGAAGAAGAGGCAGCATGA

Reference
(1) Ringel PD, Hu D, Basler M (2017). The Role of Type VI Secretion System Effectors in Target Cell Lysis and Subsequent Horizontal Gene Transfer. Cell Rep. 21(13):3927-3940. [PudMed:29281838] experimental
 
experimental experimental literature