SecReT6
Adaptor Protein ID: 560173452
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_1609
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]1689187..1689618 [+]
Producthypothetical protein
Adaptor typeProtein
Homologous adaptorSMDB11_1609 (EagR2)
DescriptionRhs2 (SMDB11_1610)
UniProt IDsmac:SMDB11_1609
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DcrB [PF08786], Evalue: 3.0e-32, Aligned region: 11..139
Relates to structure proteinVgrG2b (SMDB11_2276)
Chaperone of effectorRhs2 (SMDB11_1610)
Protein Sequence: 143 a.a.     [Download]
>gi|560173452|ref|CDG12183.1| hypothetical protein [Serratia marcescens subsp. marcescens Db11]
MSALSRCAFSEGSVALPEGYADRTVNVLLAGDDVSPSVNISRDALQPAENLEGYVTRQLDALAQGLKGWA
FKSREPASLGDGLAAGEWVRASYLRDGKRIWQNQAVFALAEGRVLVFTLAMARKLTPQDDALLLQVLSSY
RAA
-
Nucleotide Sequence: 432 bp     [Download]
>gi|560171871|ref|HG326223.1|:1689187-1689618 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGTCCGCTTTATCCCGCTGCGCTTTCAGCGAAGGCAGCGTCGCTTTGCCGGAAGGCTATGCCGATCGCA
CGGTCAACGTCCTGTTGGCCGGCGATGATGTTTCCCCCTCAGTCAATATTTCCCGCGATGCGCTGCAGCC
GGCGGAGAACCTGGAAGGCTACGTCACCCGCCAGCTCGATGCGCTGGCACAGGGGCTGAAAGGTTGGGCG
TTCAAAAGCCGCGAGCCGGCGTCGCTGGGCGATGGGCTGGCCGCCGGTGAATGGGTGCGCGCCAGCTACC
TGCGCGACGGCAAACGCATCTGGCAGAACCAGGCGGTGTTCGCCCTGGCGGAAGGCCGGGTGCTGGTGTT
CACCCTGGCGATGGCGCGCAAGCTGACGCCGCAAGACGACGCGCTGCTGCTGCAGGTGCTGAGCAGCTAC
CGGGCGGCCTAA

Reference
(1) Francesca R Cianfanelli, Juliana Alcoforado Diniz, Manman Guo, Virginia De Cesare, Matthias Trost, Sarah J Coulthurst (2016). VgrG and PAAR Proteins Define Distinct Versions of a Functional Type VI Secretion System. PLoS Pathog. 12(6):e1005735. [PudMed:27352036] experimental
 
experimental experimental literature