SecReT6
Adaptor Protein ID: 560174088
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2245
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2367474..2367863 [+]
Producthypothetical protein
Adaptor typeProtein
Homologous adaptorSMDB11_2245 (EagR1)
Description
UniProt IDsmac:SMDB11_2245
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Relates to structure proteinVgrG2b (SMDB11_2276)
Chaperone of effectorRhs1 (SMDB11_2246)
Protein Sequence: 129 a.a.     [Download]
>gi|560174088|ref|CDG12820.1| hypothetical protein [Serratia marcescens subsp. marcescens Db11]
MSKAKNVFTVIGLILLAPILSLVGFFKFITVDIWGYFKHIGSSLSVMENGISASGQIVSIRQTNLWDGNR
PVCEVEVKYIAQDGKNHTAVAKGPISVVDLPRYQPGHFTAIKYDPKNPKKAVIEELSRL
-
Nucleotide Sequence: 390 bp     [Download]
>gi|560171871|ref|HG326223.1|:2367474-2367863 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGTCGAAGGCCAAAAATGTTTTCACCGTTATCGGGTTGATTTTATTGGCTCCCATCCTCAGTCTGGTGG
GTTTTTTCAAATTCATCACGGTCGATATCTGGGGTTATTTCAAACATATCGGTTCTTCCCTCAGCGTGAT
GGAGAACGGTATTTCCGCTTCCGGGCAAATCGTCAGCATTCGCCAGACCAACCTGTGGGACGGAAATCGG
CCGGTCTGCGAAGTCGAAGTCAAGTACATCGCCCAAGACGGAAAAAACCATACGGCCGTGGCGAAAGGCC
CGATCAGCGTCGTGGATCTGCCGCGTTATCAGCCGGGCCATTTCACCGCGATAAAGTACGATCCGAAGAA
CCCCAAAAAAGCGGTGATCGAAGAGCTTTCCCGGCTTTGA

Reference
(1) Francesca R Cianfanelli, Juliana Alcoforado Diniz, Manman Guo, Virginia De Cesare, Matthias Trost, Sarah J Coulthurst (2016). VgrG and PAAR Proteins Define Distinct Versions of a Functional Type VI Secretion System. PLoS Pathog. 12(6):e1005735. [PudMed:27352036] experimental
 
experimental experimental literature