SecReT6
Effector Protein ID: 104779803
-
SecReT6 ID125
T6SS typeA1
Gene symbol-
Locus tagPSEEN0539
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]558507..559025 [+]
Producthemolysin co-regulated protein 1B
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDQ1I510
KEGG IDpen:PSEEN0539, pen:PSEEN0861, pen:PSEEN4598
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.00E-40, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|104779803|ref|YP_606301.1| hemolysin co-regulated protein 1B [Pseudomonas entomophila L48]
MATPAYMAVTGEKQGLITAGAFTADSVGNTYQEGHEDQVMVQGFEHEVIIPRDPQSGQPTGQRVHKPVKI
TKVFDKASPLLLAALTSGERMTKVEIKWYRTSAQGTQEHYYTTVLEDAIIVDIKDYMHNCQDPANAHFTH
LEDVYFTYRKITWTHEVSGTSGSDDWRAPVAG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|104779316|ref|NC_008027.1|:558507-559025 Pseudomonas entomophila L48 chromosome, complete genome
ATGGCAACTCCCGCCTACATGGCCGTCACCGGCGAAAAACAAGGTCTGATCACTGCCGGCGCCTTCACCG
CCGACTCGGTGGGCAACACCTACCAGGAAGGCCACGAAGACCAGGTCATGGTCCAGGGCTTCGAACACGA
AGTGATCATCCCGCGTGACCCGCAGTCCGGCCAGCCGACCGGCCAGCGCGTGCATAAACCAGTGAAGATC
ACCAAGGTCTTCGACAAGGCCTCGCCACTGCTGCTGGCCGCCCTGACCTCGGGCGAGCGCATGACCAAGG
TCGAGATCAAGTGGTACCGCACCTCGGCCCAGGGCACTCAAGAGCACTACTACACCACCGTCCTGGAAGA
CGCGATCATCGTCGACATCAAGGACTACATGCACAACTGCCAGGACCCGGCCAACGCCCACTTCACCCAC
CTGGAAGACGTGTACTTCACCTACCGCAAGATCACCTGGACCCACGAAGTGTCCGGTACTTCCGGTTCCG
ACGACTGGCGCGCGCCGGTCGCAGGCTAA