SecReT6
Effector Protein ID: 104784184
-
SecReT6 ID125
T6SS typeA1
Gene symbol-
Locus tagPSEEN5276
StrainPseudomonas entomophila L48
Repliconchromosome [GenBank: NC_008027] [Browse all T6SS(s) in this replicon]
Location [Strand]5594067..5594585 [-]
Producthemolysin co-regulated protein 1A
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDQ1I387
KEGG IDpen:PSEEN5276
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.20E-41, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|104784184|ref|YP_610682.1| hemolysin co-regulated protein 1A [Pseudomonas entomophila L48]
MATPAYMAVTGEKQGLITAGAFTADSVGNTYQEGHEDQVMVQGFEHEVIIPRDPQSGQPTGQRVHKPVKI
TKVFDKASPLLLAALTSGERMTKVEIKWYRTSAQGTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTH
LEDVHFTYRKITWTHEVSGTSGSDDWRAPVAG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|104779316|ref|NC_008027.1|:c5594585-5594067 Pseudomonas entomophila L48 chromosome, complete genome
ATGGCAACTCCCGCCTACATGGCCGTCACCGGCGAAAAACAAGGTCTGATCACTGCCGGCGCCTTCACCG
CCGACTCGGTGGGCAACACCTACCAGGAAGGCCACGAAGACCAGGTCATGGTCCAGGGCTTCGAACACGA
AGTGATCATCCCGCGTGACCCGCAGTCCGGCCAGCCGACCGGCCAGCGCGTGCACAAGCCGGTGAAGATC
ACCAAGGTCTTCGACAAGGCCTCGCCGCTGCTGCTGGCTGCCCTGACCTCGGGCGAGCGCATGACCAAGG
TCGAGATCAAGTGGTACCGCACCTCGGCCCAGGGCACCCAGGAGCACTACTACACCACCGTCCTGGAAGA
CGCGATCATCGTCGACATCAAGGACTACATGCACAACTGCCAGGACCCGGGCAACGCCCACTTCACCCAC
CTGGAAGACGTGCACTTCACCTACCGCAAGATCACCTGGACCCACGAAGTGTCCGGTACTTCCGGTTCCG
ACGACTGGCGCGCGCCGGTCGCAGGCTAA