SecReT6
Effector Protein ID: 108758680
-
SecReT6 ID127
T6SS typeA1
Gene symbol-
Locus tagMXAN_5572
StrainMyxococcus xanthus DK 1622
Repliconchromosome [GenBank: NC_008095] [Browse all T6SS(s) in this replicon]
Location [Strand]6920542..6922551 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorMXAN_5572
DescriptionMXAN_5572(TsxE)contains amidohydrolase 2 (AH2) and LysM (LM) domains.
UniProt IDQ1D0W2
KEGG IDmxa:MXAN_5572
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 669 a.a.     [Download]
>gi|108758680|ref|YP_633711.1| hypothetical protein MXAN_5572 [Myxococcus xanthus DK 1622]
METYVVKDGDSPDSIAQKYGFKEWKLIYEHPDNGGLRATRGANEVKADDRVIIPDLPENQVSAGGPQNLI
ATPGTPLTLPPVHFDAHMHIMSGNCTPMPALVQMMKDKGLGFLIGTGTSRTKINRLGFWAAKIPFAPDIG
DVSHRDTHRIGEEAVRSNDSLAQDRTGYTSDGMGNVEEYTIPAPLRAYASTQGHAEASASYMGMSIVLTM
DMDYCHLAGYQGDPIYSSDFDGAEPRFTYRWRTKSDDPGELIEAKSDEIRLHETWDRQLRHTEQVVAENP
FRLLPMFHFEPRRFIKNEDKSFPFEKVVTASKAAPYIGFKMYTPQGYMPKERHAPVKDILSWFFSECASN
DIPLMTHCTPSGFYTHERRFYLDHEPDEAIRNDPKYWPSKDAIATADANITKARDYVTELEASWKSHIPL
VLRRARNGVEDAIEAKEKLLNPGRMRYFYENYVHPEAWRPVLNDNPKLRLCLAHFASDGTFWDIRKGLTV
KQDGQKVQYDKSWIGSIVELCNEFPNFYTDISYLDLMEKQKWKLLADILKSSPWMLKKIMFGTDWYMITA
EPVAYAAWYSRTIRGLEFIQKELPTQVNLFTQFAIVNPMRYYRMMEVAPKMKEGLKKLQTDLNVTGAAVD
KLEDNFTTLMRLQHPLEQIDKAGGLASGPMLFTATTKAK
-
Nucleotide Sequence: 2010 bp     [Download]
>gi|108756767|ref|NC_008095.1|:c6922551-6920542 Myxococcus xanthus DK 1622 chromosome, complete genome
ATGGAAACGTACGTCGTCAAGGACGGGGACTCCCCCGACTCAATCGCGCAGAAGTACGGGTTCAAGGAAT
GGAAGCTCATCTACGAGCATCCGGACAACGGGGGCCTGCGCGCCACTCGCGGCGCCAATGAAGTGAAGGC
GGATGACCGGGTCATCATCCCGGACCTGCCAGAGAACCAGGTGTCCGCCGGAGGTCCGCAGAACCTCATC
GCCACGCCGGGAACGCCGCTCACCTTGCCGCCCGTCCACTTCGACGCACACATGCACATCATGAGCGGTA
ACTGCACGCCCATGCCCGCGCTGGTGCAGATGATGAAGGACAAGGGCCTGGGCTTTCTCATCGGCACGGG
CACCAGCCGCACCAAAATCAACCGCCTGGGCTTCTGGGCGGCGAAAATCCCGTTCGCGCCCGACATCGGT
GATGTGTCCCACCGCGACACGCACCGCATTGGTGAAGAGGCCGTGCGCTCCAATGACAGCCTTGCCCAGG
ACCGGACGGGATACACCTCGGATGGAATGGGCAACGTGGAGGAGTACACCATCCCCGCGCCCCTGCGAGC
CTATGCGTCCACGCAGGGCCACGCGGAGGCCAGCGCTTCCTACATGGGCATGTCCATCGTCCTCACCATG
GACATGGATTACTGCCACCTGGCTGGCTACCAGGGGGACCCTATCTACAGCTCGGATTTTGATGGGGCCG
AGCCCCGCTTCACCTATCGCTGGCGCACGAAGTCCGACGACCCTGGCGAGCTGATTGAAGCGAAGTCCGA
TGAGATACGGCTTCACGAGACGTGGGACCGGCAGCTCCGGCACACCGAGCAGGTGGTCGCGGAGAATCCC
TTCCGGTTGCTGCCCATGTTTCATTTCGAACCGCGCCGCTTCATCAAGAACGAGGACAAGTCGTTCCCCT
TCGAAAAGGTGGTGACGGCCTCCAAGGCGGCTCCCTACATCGGCTTCAAGATGTACACGCCCCAGGGCTA
CATGCCCAAGGAGCGCCATGCGCCGGTGAAGGACATCCTGAGCTGGTTCTTCTCCGAGTGCGCGTCGAAC
GACATCCCGCTGATGACCCACTGCACGCCGTCCGGCTTCTACACACACGAGCGGCGCTTCTACCTGGACC
ACGAGCCGGACGAGGCCATCCGAAACGACCCGAAGTACTGGCCCTCGAAGGACGCCATCGCCACCGCGGA
CGCGAACATCACCAAGGCGCGCGACTACGTGACGGAGCTGGAGGCGAGCTGGAAGAGCCACATCCCGCTC
GTGCTCCGCCGCGCGCGCAATGGCGTGGAGGACGCCATCGAGGCCAAGGAGAAGCTGCTGAACCCGGGCC
GGATGCGTTACTTCTATGAGAACTACGTGCACCCGGAAGCGTGGCGCCCGGTGCTCAATGACAATCCGAA
GCTGCGCTTGTGCCTGGCGCACTTCGCCAGCGACGGCACCTTCTGGGACATCCGCAAGGGGTTGACCGTC
AAGCAGGATGGCCAGAAGGTCCAGTACGACAAGAGCTGGATTGGCTCCATCGTCGAGCTGTGCAACGAGT
TCCCCAACTTCTACACGGACATCTCCTATCTGGACCTGATGGAGAAGCAGAAGTGGAAGCTGCTGGCTGA
CATCCTCAAGTCCAGTCCGTGGATGCTGAAGAAGATCATGTTCGGCACCGACTGGTACATGATTACCGCC
GAGCCCGTGGCGTACGCGGCTTGGTACAGCCGCACCATCCGCGGGCTGGAGTTCATCCAGAAGGAGCTGC
CGACGCAGGTGAACCTCTTCACCCAGTTCGCCATCGTCAATCCCATGCGCTACTACCGCATGATGGAGGT
CGCCCCGAAGATGAAGGAGGGCCTCAAGAAGCTTCAAACGGACCTCAACGTGACGGGCGCCGCGGTGGAC
AAGCTCGAGGACAACTTCACGACGCTGATGCGGCTGCAGCACCCGCTGGAGCAGATTGACAAGGCGGGCG
GCCTGGCCAGCGGTCCCATGTTGTTCACCGCGACCACGAAGGCGAAGTAG

Reference
(1) Troselj V, Treuner-Lange A, Søgaard-Andersen L, Wall D (2018). Physiological Heterogeneity Triggers Sibling Conflict Mediated by the Type VI Secretion System in an Aggregative Multicellular Bacterium. mBio. 9(1). pii: e01645-17. [PudMed:29437919] experimental
 
experimental experimental literature