SecReT6
Effector Protein ID: 115314916
-
SecReT6 ID471
T6SS typeB
Gene symbol-
Locus tagFTH_1136
StrainFrancisella tularensis subsp. holarctica OSU18
Repliconchromosome [GenBank: NC_008369] [Browse all T6SS(s) in this replicon]
Location [Strand]1110770..1111921 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorFTL_0118
DescriptionIglI protein
UniProt IDQ0BLN2
KEGG IDfth:FTH_1136, fth:FTH_0110
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 383 a.a.     [Download]
>gi|115314916|ref|YP_763639.1| hypothetical protein FTH_1136 [Francisella tularensis subsp. holarctica OSU18]
MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFLSLNSEICLNL
DTVDNISKIISSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDANFAQMQNQDKLLPNNIDSIIE
IVQEVIIFFEKNNLNYNSDFKIQLNKTLRKIKSSLILKDQKNDTYSDKESINQVEATITDQKTIQGSEKW
KTLIEKIEVLKALVESERIFETSIVYNDIQNLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSS
IQWSIAQKMYNIDYKSFLDTLEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIADTDAIKEEIV
IKQRTNNKKNQNDPVEKISNKIDEDYFEDLFDI
-
Nucleotide Sequence: 1152 bp     [Download]
>gi|115313981|ref|NC_008369.1|:c1111921-1110770 Francisella tularensis subsp. holarctica OSU18 chromosome, complete genome
ATGAGTCAGATAATATCTACACTAAATAATATTGATTTAGTAACTCAAGATAAAGTAAATCTGATTAGTA
ATATGCAAATACAAGCAAAATATGAAAACGCTGAGTATAAGTCATTTATTGATCAATTAATAGATAATCT
TAATACTACTAGAAGCATAGATATATATAACTTATTTCTATCTTTAAATTCAGAAATATGCCTCAATTTA
GATACGGTTGATAATATCTCTAAAATTATTAGCTCTTATTTATCTATTCTAAATACTAATTTCACAAGAA
TTAGTCCATCAGAATCAAAGCAAAAAAACCAGCTAGCTGAAAAAGGAATAAACAAATTCTTAGTCACTAT
GGATGCAAATTTTGCGCAAATGCAGAATCAAGACAAGTTGTTACCAAATAACATAGATTCTATTATAGAA
ATTGTACAGGAAGTAATAATATTTTTTGAGAAAAATAACTTAAATTATAATTCTGATTTTAAAATCCAAC
TAAATAAGACTCTCAGAAAAATAAAAAGTTCTTTGATTTTAAAAGATCAAAAAAATGATACGTATTCCGA
TAAAGAATCAATAAATCAAGTTGAAGCAACTATCACAGATCAAAAAACCATACAAGGCTCTGAGAAATGG
AAAACTCTTATTGAAAAAATTGAAGTTTTAAAAGCTCTAGTTGAAAGTGAAAGAATATTTGAAACATCTA
TTGTTTATAATGATATACAAAACTTATTAGTTAACTTCGATCCTAAAGAGTATTTTCCAGAAATTTTCTT
TCCATTATACAAGAAGATAGCTCCTTTTATTGGCAATATCCATAAAAACATAGACTACTACTCATCAAGT
ATTCAGTGGAGTATAGCTCAGAAGATGTACAACATAGATTATAAGAGTTTTCTAGATACTCTTGAGAAAA
TGCCCGAAAATAATTTTTTAAATTCTTCTTCTGATATAACTAAAAATTTCTTTTATGAAACATCCTCAGA
GGTGGAAAAAACTCCTATCGAAGAACATAAAATAATTGCAGATACAGATGCTATCAAAGAAGAAATAGTA
ATAAAACAGCGAACCAATAATAAAAAAAACCAGAATGACCCCGTAGAAAAAATTTCAAATAAAATAGATG
AAGACTATTTTGAAGATCTTTTTGACATATAA