SecReT6
Effector Protein ID: 115350437
-
SecReT6 ID148
T6SS typeA4b
Gene symbol-
Locus tagBamb_0383
StrainBurkholderia ambifaria AMMD
Repliconchromosome I [GenBank: NC_008390] [Browse all T6SS(s) in this replicon]
Location [Strand]427925..428428 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDQ0BIT1
KEGG IDbam:Bamb_0383
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-43, Aligned region: 7..139
Protein Sequence: 167 a.a.     [Download]
>gi|115350437|ref|YP_772276.1| hypothetical protein Bamb_0383 [Burkholderia ambifaria AMMD]
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSP
LLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|115350056|ref|NC_008390.1|:427925-428428 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGTTACATATGCACTTGCAGTTTGGTAGTCCCGCGGTGAAGGGCGAGTCCGCGGACAAGGACCACCAGG
GCTGGATCGAGCTGAAATCGTGGGATCACTCGATCGTTCAACCGCGTTCGGCAACCGCATCGACCGCTGG
CGGTCACACGATGACGCGTTGCGAGCACGGCGACATGATTTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTACCAACACGCTTCGGGCGGCACCACGTTCGACGAGGTGACGGTCCATTTCTCGCGCGCTGACG
GTGAAGGCAAGCGCGTGCAGTATCTGGAAGTCAAGCTTAAGTACGTGATCATCTCGAGCATCGCCCCGAG
CGTTCGCGAGGAAGGTCTGCCGCTCGAGACGTTCTCGCTGAAGTACGCAGCTGTGCAGTGGAAGCAAACC
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGTCTGACGAAGAACGACAAGA
CCTACGCGGTCTAA