SecReT6
Effector Protein ID: 115359953
-
SecReT6 ID148
T6SS typeA4b
Gene symbol-
Locus tagBamb_5209
StrainBurkholderia ambifaria AMMD
Repliconchromosome I [GenBank: NC_008391] [Browse all T6SS(s) in this replicon]
Location [Strand]2244169..2246937 [-]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I3225
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ0B516
KEGG IDbam:Bamb_5209
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.90E-59, Aligned region: 45..377
DUF2345 [PF10106], Evalue: 3.10E-46, Aligned region: 222..254
DUF2345 [PF10106], Evalue: 3.10E-46, Aligned region: 619..643
DUF2345 [PF10106], Evalue: 3.10E-46, Aligned region: 702..849
T6SS_Vgr [PF13296], Evalue: 8.30E-38, Aligned region: 562..670
T6SS_Vgr [PF13296], Evalue: 8.30E-38, Aligned region: 728..760
Phage_base_V [PF04717], Evalue: 2.90E-18, Aligned region: 461..545
DUF3540 [PF12059], Evalue: 0.0061, Aligned region: 381..443
DUF3540 [PF12059], Evalue: 0.0061, Aligned region: 508..551
DUF3540 [PF12059], Evalue: 0.0061, Aligned region: 731..757
DUF3540 [PF12059], Evalue: 0.0061, Aligned region: 769..799
Protein Sequence: 922 a.a.     [Download]
>gi|115359953|ref|YP_777091.1| Rhs element Vgr protein [Burkholderia ambifaria AMMD]
MSIAKTLRNFASGLIDGNPRPVDLHFGRAQRAVGHLLALHHADIHEGLMSGIDGQLTCVSTHDHLSPALF
LGLPVSVRVTADRGGVRAINAIVREVRTGQSDGELTVYQLQVCDALSLMEGRTNARVFRSRSVPEILTTL
MNEWKQRSYALARAFDFDLSGLQADRYPVRELTRQVNESDARFIRRLLRREGITVFAQAETVGRVHGMAD
EQPVHTLVFCDDPHCLKEAPAGALRLHPRDAGAAQRDTVTLFAHRQRLSSGKVRRPSWDYKTARIDDSTA
VASLHQGESGNDLAHLLTDVAIDIPHVGDSWNDHDRITRDRILAHQFEAERYDGISNVRDLPVGHWFTLT
GDPELDMKPVEHRRFVVTSVRHDIRNNLPTQLASRAQGLFAASRNLTETVPAIPADPAEQTDTRYENRFT
CVRRGVPLKPAYDPKIDVPPVHLLTGTIVGMQGEEVFCDSAGRVRVRIHGYDPADHAHAQGAGTNGRAGD
SAPIRVGANLAGGNFGTLFLPRVGMEVLLGCLAGDPDRLVIIGVLSNGANPPATFSHTGALPGNRFLSGI
KTKEINGRRYNQLRLDDTPSQISAQLASEHAHTELNLGYLTQPRENGHGEARGEGAELRTDAAAALRAAR
GILLSTYARTRATGGQLDRDELIRLLDQCTELFKSLGDYAGQHGGQSADTSGQDNVASAFRNWTPGGAPA
GAADDACALLAFGAQSGALHVTPKTHVIHAGENIDQVAQQHVQVTSGERINLHAGRGVAMFAHGDGVSAI
ANQGKVTIQSQNDDTRVDSAKNIQLTAAGGKLVGTASDEVVLVTSGGAYLRLRGGDIELGCPGTFTVKSA
GHAWDGPASMNADMPTFAQDTLGRVPKLVRATDGHAAAGFEGEIQKPSGPVSNVSSDVAGQLPAVDADQF
ERLAVRFIKKNV
-
Nucleotide Sequence: 2769 bp     [Download]
>gi|115357970|ref|NC_008391.1|:c2246937-2244169 Burkholderia ambifaria AMMD chromosome 2, complete sequence
ATGTCGATAGCAAAAACGCTCCGTAATTTTGCGTCTGGTCTGATTGACGGAAACCCGCGGCCGGTCGATC
TCCATTTCGGGCGCGCGCAACGCGCGGTCGGCCATCTGTTGGCGCTCCATCACGCCGATATCCACGAAGG
GCTGATGTCCGGCATCGACGGGCAGCTGACCTGCGTATCCACCCACGACCATCTGTCGCCTGCGCTGTTT
CTCGGGCTGCCCGTGTCGGTTCGGGTGACGGCCGATCGGGGCGGCGTACGCGCGATCAATGCGATCGTGC
GCGAAGTGCGGACCGGTCAATCCGACGGCGAGCTGACCGTCTATCAACTGCAGGTGTGTGACGCGCTGTC
GTTGATGGAGGGCCGCACGAACGCCCGCGTGTTCCGCTCGCGCAGCGTGCCGGAAATCCTCACGACGCTG
ATGAACGAATGGAAACAGCGCAGCTACGCACTCGCGCGCGCGTTCGATTTCGACTTGTCCGGGCTGCAGG
CCGATCGCTATCCGGTGCGCGAGCTCACGCGCCAGGTCAACGAATCGGACGCGCGCTTCATCCGGCGTCT
GCTGCGCCGGGAAGGCATCACGGTCTTCGCGCAGGCCGAGACGGTCGGCCGCGTGCACGGCATGGCCGAC
GAGCAGCCGGTTCACACGCTCGTATTTTGCGACGATCCGCATTGTTTGAAGGAGGCACCGGCCGGTGCGC
TGCGCCTTCACCCTCGCGATGCGGGCGCTGCGCAGCGCGACACGGTGACGCTCTTTGCGCACCGCCAGCG
CCTGTCGTCCGGCAAGGTCCGCCGTCCGTCGTGGGACTACAAGACGGCTCGCATCGACGATTCAACGGCC
GTCGCCAGCCTCCATCAGGGTGAATCGGGAAACGATCTGGCCCACCTGCTGACCGACGTCGCGATCGACA
TCCCGCACGTCGGCGATTCGTGGAACGACCACGACCGCATCACGCGCGACCGGATACTGGCTCACCAGTT
CGAAGCCGAGCGATACGACGGGATCAGCAACGTGCGCGATTTGCCGGTCGGCCACTGGTTCACGCTGACG
GGCGACCCGGAACTGGATATGAAGCCCGTCGAGCATCGTCGGTTCGTCGTCACGTCGGTTCGACACGATA
TCCGCAACAACCTGCCAACGCAGCTCGCGAGCCGGGCGCAGGGACTCTTCGCGGCGAGCCGTAACCTGAC
GGAAACCGTTCCGGCGATACCTGCCGATCCAGCGGAGCAAACCGACACACGCTACGAGAACCGCTTCACG
TGCGTGCGGCGCGGCGTGCCGCTCAAACCCGCCTACGATCCGAAGATCGATGTGCCGCCGGTTCACCTGC
TGACCGGCACGATCGTCGGCATGCAGGGCGAGGAAGTGTTTTGCGACAGCGCCGGCCGCGTACGCGTGCG
GATTCACGGTTACGACCCGGCCGATCATGCGCACGCGCAAGGCGCCGGAACGAACGGCCGGGCTGGTGAC
AGCGCACCGATCCGCGTCGGAGCAAATCTGGCGGGCGGCAACTTCGGGACGCTCTTCCTGCCCCGCGTCG
GCATGGAAGTCCTGCTGGGATGTCTTGCAGGCGACCCAGACCGGTTGGTCATCATCGGCGTGCTGAGCAA
TGGCGCGAACCCGCCCGCGACCTTCAGCCATACCGGCGCGCTTCCCGGCAACCGGTTCCTCTCCGGTATC
AAGACCAAGGAAATCAACGGCAGGCGTTATAACCAGCTTCGTCTGGACGATACGCCGTCGCAAATCTCGG
CGCAGTTGGCGAGCGAACATGCGCATACCGAATTGAATCTCGGGTATCTGACGCAGCCGCGAGAAAACGG
ACATGGTGAGGCGCGCGGCGAAGGCGCGGAGCTGCGCACCGATGCCGCCGCCGCATTGCGCGCCGCGCGC
GGCATCCTGCTGTCGACCTATGCGCGCACACGGGCCACCGGTGGTCAGCTCGATCGCGATGAACTGATTC
GCCTGCTCGATCAATGCACCGAACTCTTCAAATCGCTCGGCGATTACGCCGGCCAGCACGGCGGACAGTC
CGCCGACACCAGCGGGCAGGACAACGTCGCCAGTGCATTCCGCAACTGGACGCCTGGCGGTGCACCAGCC
GGCGCGGCCGACGATGCGTGCGCGCTGCTCGCATTCGGCGCGCAGTCCGGGGCCCTCCACGTCACGCCCA
AAACGCACGTCATCCATGCGGGCGAGAACATCGATCAAGTCGCGCAACAACATGTGCAAGTCACGAGCGG
CGAACGCATCAATCTGCATGCCGGTCGCGGCGTCGCGATGTTTGCGCACGGCGACGGCGTGTCGGCGATC
GCGAATCAGGGGAAGGTCACGATCCAGTCGCAGAACGACGATACGCGCGTCGACTCGGCGAAGAACATTC
AATTGACCGCAGCGGGCGGGAAGCTCGTCGGCACCGCGAGCGATGAAGTCGTGCTCGTTACGTCCGGTGG
TGCGTATCTCCGGCTGCGCGGCGGCGATATCGAGCTGGGATGCCCCGGCACGTTCACGGTGAAGTCGGCT
GGTCATGCTTGGGATGGTCCGGCGAGCATGAACGCGGACATGCCGACATTCGCTCAGGACACGCTTGGCC
GGGTGCCAAAGCTCGTCCGCGCGACGGACGGCCACGCGGCGGCGGGATTCGAAGGCGAAATTCAAAAGCC
ATCCGGGCCGGTGTCCAATGTGTCGAGCGACGTGGCCGGCCAACTGCCCGCCGTCGATGCCGACCAGTTC
GAAAGACTGGCGGTGCGATTCATCAAGAAAAACGTATAG