SecReT6
Effector Protein ID: 116049601
-
SecReT6 ID152
T6SS typeA1
Gene symbol-
Locus tagPA14_43100
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3835369..3840213 [+]
ProductRhs family protein
Effector typeProtein
Homologous effectorPA14_43100
DescriptionRhsP2
UniProt IDQ02KE2
KEGG IDpau:PA14_43100
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 562..582
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 632..656
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 698..733
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 739..768
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 802..836
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 842..878
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 884..920
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 929..957
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 970..1001
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 1017..1049
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 1057..1085
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 1077..1104
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 1135..1147
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 1138..1173
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 1163..1197
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 1184..1211
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 1238..1276
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 1265..1290
RHS_repeat [PF05593], Evalue: 6.40E-63, Aligned region: 1344..1362
RHS [PF03527], Evalue: 1.40E-14, Aligned region: 816..836
RHS [PF03527], Evalue: 1.40E-14, Aligned region: 904..916
RHS [PF03527], Evalue: 1.40E-14, Aligned region: 1237..1248
RHS [PF03527], Evalue: 1.40E-14, Aligned region: 1328..1336
RHS [PF03527], Evalue: 1.40E-14, Aligned region: 1344..1380
Protein Sequence: 1614 a.a.     [Download]
>gi|116049601|ref|YP_791594.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MISSFYAMFMLRGVNAKQPDASQLIGEFSSGVLNRYEEYANSWLWGWALDVQQTIALSDGNGNELTRLKA
DKDANILEDVASCPVNGQLKLLHTFESTSFVPIGNTPYEITRIGSRTPQFKGVLDADGMASISGCAPNTL
YQVKFYPEVSIQEIDALYRSYDDVIAKLNEWLLEQWNGPLSAEWKRLAPVGDRRRMEQINDAYLDGMGKA
LVNLWDDVVELFGILANLDEHAAKLLEFINEADFEKLKAQAKELLGTALLIASDEPLLFIYASAIVCWTQ
LLPPTTAAEMVAELSTGLLLDILLGIILTGGAGLAVRLAVKGSKAIKASEGAMLLRKAMQVLIDTSCRHS
LQLHAEKLKPLAVRGEVMANSSNKITAQIQSTAQGIARTEHDTLPLSRGKRANTSLSSSQATPDASAPGR
TPAGKPADQAAQTCVKDCPVSMVTGEELLTLTDCELDGPLRFAWTRLYRTSAAEIDNGLGFGWSHALSHR
LDRDGDELVWTDHENRRTRFPIPDAQRPAITNRLSRAAIYLGGDPSELILAQAGEKPRFYHFRKDPDGAY
LIAISDAYGNRLELSRDRLGRPRRLSHKAGRALLLCYQGRHIERVEYQVYQPADNLEACWHTTQVLARYR
CNERGQLIEAGNALYEAERYRYDARNVILERQLAGGASFFWEWEGEGKQARAVHHWASFPQMDSRYVWNE
DGSVTAINADGSEEVYVHDDNARLVRQVDPDGGETLRHYDEKGQLVAERDPLGTITEYRYDQAGRLEALL
PAEGEPTCYSYFDGFVRSVRRGEAQWKYERNTQGDITRQTDPEGNVTHYAYDHRGCLVEITHADGSLHQL
TWNPLGQLIEEQLPDGSVRRYRYDTLGRQITRQDESGAITRFQWDAAGRLSQITLPGGASRMYRYNAYGK
VTSECDEQGRMTRYEYLDDLHLVSRRINPDGSQLRYRYENARLLLSEIENERGERYRLDYHGNGLISQET
GFDGRRTAYRYDLKGQLLEKTEYGDDGSELRTTYQRDSTGRLLAKTLPDGNRVDYRYDTLGRLVAVDDGT
WPLAYEYDLRDRLVREHQGWATLHYAYDALGQLIHCRLPDGNRVDYRYQTGGTLSAIDLNGQSLTRHQFG
SGRERQRQQGELLSQYHYDEQGRLLAHQVSQRQRHLYQRQYRYDASGNLAAIEDSRKGIRSFHYDPLDRL
LGVRGETPESFVHDPAGNLLAQGGQFDARQMEVRGNRLLTQGDRHFDYDAHGNLVRERRGTGQKLVTEYS
YDCQHRLIGVSLPDGRQVVYRYDAFGRRIAKQVDGRNTEFLWLGERLLAESGDRHYRTYLYEPDSFRPLA
LLDGEGPEQVEPCYYQLDHLGTPQELTRADGRLCWSARYRAYGNVLKLDIAEVDNPLRFQGQYFDAETGL
HYNRHRYYNPSTGRYLTPDPIRLAGGLNSYRYVPNPTGWVDPLGLASNKTRCPEALDNNPRKGINSTSGS
KKPAGPIVELDAQGNEIYYRTLSEQHLEILRNNFEVPPTSETFISPLQSYSQEYDGKLVRLTASPGTMNE
LSKIGVTANSGTGLLLPDLPPARKGWKQNNALFKLEALKKPTINEGGGVINTGLGDGKALEIFNKNLIDF
EVID
-
Nucleotide Sequence: 4845 bp     [Download]
>gi|116048575|ref|NC_008463.1|:3835369-3840213 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGATCTCGTCGTTCTACGCCATGTTCATGCTGCGCGGAGTGAACGCGAAGCAGCCGGATGCCAGCCAGT
TGATCGGCGAATTCAGCTCCGGGGTGCTCAACCGCTATGAGGAATATGCGAACAGTTGGCTCTGGGGCTG
GGCACTCGACGTCCAGCAGACCATCGCCCTTTCCGATGGGAACGGCAACGAGTTGACCAGGCTGAAAGCC
GACAAGGACGCCAACATCCTCGAAGACGTCGCCTCATGTCCGGTCAACGGTCAACTGAAACTGCTGCATA
CTTTCGAATCGACCAGTTTCGTGCCCATCGGCAACACGCCTTACGAAATCACTCGGATAGGCAGCAGGAC
ACCGCAGTTCAAGGGCGTACTGGATGCAGATGGGATGGCGAGCATAAGCGGCTGCGCTCCCAATACGCTG
TACCAGGTCAAGTTCTACCCAGAGGTAAGCATCCAGGAGATCGACGCGCTCTACCGCTCCTACGACGACG
TAATCGCCAAGCTGAACGAGTGGCTTCTGGAGCAATGGAACGGCCCGCTTTCCGCCGAATGGAAAAGGCT
CGCGCCGGTTGGCGACCGTAGGCGGATGGAGCAGATAAACGACGCCTATCTGGACGGCATGGGCAAAGCG
CTGGTCAATCTCTGGGATGATGTGGTCGAGCTGTTCGGCATCCTCGCGAACCTCGACGAGCACGCGGCGA
AACTCCTTGAGTTCATCAACGAAGCGGATTTCGAAAAGCTCAAGGCTCAGGCCAAGGAACTCCTCGGTAC
CGCCTTGCTGATCGCCAGCGACGAACCGCTTCTGTTCATCTATGCCAGCGCCATCGTGTGCTGGACCCAG
TTGCTGCCGCCCACGACTGCCGCGGAAATGGTCGCGGAACTCTCCACCGGCCTGCTCCTCGATATTCTGC
TCGGCATCATCCTGACCGGCGGAGCCGGTCTCGCCGTTCGCCTGGCCGTCAAGGGCTCGAAAGCAATCAA
GGCCTCCGAAGGTGCGATGCTGCTGCGCAAAGCCATGCAGGTGCTGATCGATACCAGCTGTCGGCATTCC
CTCCAGTTGCACGCGGAAAAGCTGAAACCTCTGGCCGTCCGCGGTGAAGTGATGGCCAACAGCTCCAACA
AGATCACCGCACAGATCCAGAGCACCGCCCAAGGCATCGCCCGCACCGAGCACGACACCCTGCCGCTGAG
CCGAGGAAAGCGCGCGAACACCTCGCTCTCCAGCAGTCAGGCGACGCCCGATGCCTCCGCACCCGGCAGG
ACGCCCGCCGGCAAACCCGCCGACCAGGCCGCCCAGACCTGCGTCAAGGACTGTCCCGTTTCGATGGTCA
CCGGCGAGGAGCTGCTGACCCTGACCGACTGCGAGCTGGACGGTCCGCTGCGTTTCGCCTGGACGCGCCT
GTACCGCACCAGCGCGGCGGAAATCGACAATGGTCTGGGCTTCGGCTGGAGCCATGCCCTCTCCCATCGC
CTCGATCGCGACGGCGACGAGCTGGTATGGACCGATCACGAGAACCGCCGGACCCGCTTCCCGATCCCTG
ACGCCCAGCGCCCGGCGATCACCAACCGACTGTCGCGCGCCGCCATCTACCTCGGCGGCGACCCATCCGA
ACTGATCCTTGCCCAGGCCGGCGAAAAGCCGCGCTTCTACCACTTCCGCAAAGACCCGGACGGCGCTTAC
CTGATCGCCATCAGCGACGCCTACGGCAACCGCCTGGAACTGAGTCGCGACCGCCTCGGCCGGCCGCGCC
GCCTCAGCCACAAGGCCGGGCGCGCGCTACTGCTGTGCTACCAGGGCAGGCACATCGAGCGCGTCGAGTA
CCAGGTGTACCAGCCCGCCGATAACCTGGAGGCCTGCTGGCACACCACCCAGGTACTCGCCCGCTACCGC
TGCAACGAACGTGGCCAGTTGATCGAAGCCGGAAACGCACTCTACGAGGCCGAACGCTATCGCTACGACG
CGCGCAATGTCATCCTCGAGCGCCAGTTGGCCGGCGGCGCCTCGTTCTTCTGGGAATGGGAAGGCGAAGG
CAAGCAGGCCCGCGCGGTCCATCACTGGGCCAGCTTCCCGCAGATGGACTCGCGCTACGTCTGGAACGAA
GACGGCAGCGTTACCGCGATCAACGCCGACGGCAGCGAGGAAGTCTATGTCCACGACGACAACGCGCGCC
TGGTACGCCAGGTCGATCCCGACGGAGGCGAAACCCTCAGGCACTACGACGAGAAGGGCCAACTGGTCGC
CGAACGCGATCCGTTGGGAACGATCACCGAGTACCGCTACGACCAGGCCGGACGCTTGGAGGCACTGCTC
CCGGCCGAAGGCGAGCCAACCTGCTATAGCTACTTCGACGGCTTCGTGCGCAGCGTGCGCCGCGGCGAGG
CGCAGTGGAAGTACGAGCGCAACACTCAGGGCGACATCACCCGCCAGACCGATCCCGAAGGCAACGTCAC
CCACTACGCCTACGACCACCGCGGCTGCCTGGTGGAAATCACCCATGCCGACGGCAGCCTGCACCAGTTG
ACCTGGAATCCGCTCGGCCAGTTGATAGAAGAACAGCTTCCGGACGGTAGCGTGCGCCGCTATCGCTACG
ACACACTGGGTAGACAGATCACCCGCCAGGACGAAAGCGGCGCCATCACCCGGTTCCAGTGGGATGCAGC
AGGCCGCCTGAGCCAGATCACCCTGCCCGGTGGCGCCAGCCGCATGTACCGCTACAACGCTTACGGCAAG
GTCACCAGCGAGTGCGACGAACAGGGCCGGATGACCCGCTACGAATATCTTGACGACCTGCACCTGGTCA
GCCGGCGGATCAACCCGGACGGCAGTCAGCTGCGCTACCGCTACGAAAACGCCCGGCTACTGCTCAGCGA
GATCGAGAACGAACGCGGCGAACGCTATCGCCTCGATTACCACGGCAACGGCCTGATCAGCCAGGAAACC
GGCTTCGACGGCCGCCGCACCGCCTATCGCTACGACCTCAAAGGCCAGCTTCTGGAGAAAACCGAGTACG
GCGACGACGGCAGCGAACTGCGCACCACCTACCAGCGCGACAGTACCGGGCGCCTGCTGGCGAAGACACT
GCCCGACGGCAATCGGGTCGACTACCGCTACGATACGCTCGGACGCCTGGTCGCCGTCGACGACGGCACC
TGGCCGCTGGCCTACGAATACGACCTACGGGACCGCCTGGTCCGCGAGCACCAGGGCTGGGCCACCCTTC
ACTACGCCTACGACGCCCTCGGCCAGTTGATCCACTGCCGACTGCCCGACGGCAACCGCGTCGACTACCG
CTACCAGACCGGCGGCACCCTCTCGGCAATCGATCTCAACGGCCAGTCCCTGACCCGGCACCAGTTCGGT
AGCGGTCGCGAACGCCAGCGCCAGCAGGGCGAACTGCTCAGCCAATACCACTACGATGAGCAGGGCCGCC
TGCTGGCCCACCAGGTCAGTCAGCGGCAGCGCCATCTCTACCAGCGCCAGTACCGCTATGACGCTAGCGG
CAACCTGGCCGCCATCGAGGACAGCCGCAAGGGCATTCGCAGCTTCCACTACGACCCGCTGGACCGCCTG
CTCGGCGTACGCGGTGAAACCCCGGAAAGCTTCGTGCACGACCCGGCCGGCAACCTGCTCGCCCAGGGCG
GGCAATTCGACGCGCGACAGATGGAGGTTCGCGGAAATCGCCTGCTGACGCAGGGCGACCGGCATTTCGA
CTACGACGCCCACGGCAATCTCGTTCGCGAACGCCGCGGCACCGGGCAGAAGCTGGTCACCGAATACAGC
TACGACTGCCAACACCGCCTGATCGGCGTCAGCCTGCCGGACGGGCGCCAGGTCGTCTACCGCTACGACG
CCTTCGGCCGACGCATTGCCAAGCAGGTCGACGGGCGCAATACCGAGTTCCTCTGGCTCGGCGAACGCCT
GCTCGCCGAGAGCGGCGACCGGCACTACCGCACCTATCTCTACGAACCCGACAGCTTCCGCCCGCTGGCC
CTGCTCGACGGCGAAGGCCCGGAACAGGTCGAACCCTGCTACTACCAACTCGACCACCTCGGTACCCCGC
AGGAACTGACCCGCGCCGATGGCCGCCTCTGCTGGTCGGCGCGCTACCGGGCTTACGGCAATGTGCTCAA
GCTGGACATCGCCGAAGTGGATAACCCACTGCGCTTCCAGGGCCAGTATTTCGACGCCGAGACCGGGCTG
CACTACAACCGCCATCGCTACTACAATCCAAGCACGGGACGCTACCTGACCCCCGATCCGATCAGGCTGG
CAGGTGGGTTGAACAGCTACCGGTACGTGCCGAATCCGACGGGGTGGGTGGACCCGTTGGGGCTGGCCTC
AAATAAAACTCGCTGTCCCGAAGCATTAGACAATAATCCCCGCAAAGGGATTAACTCCACATCCGGCAGC
AAAAAGCCGGCAGGACCAATCGTAGAGCTGGATGCGCAGGGAAACGAGATTTACTACCGAACACTAAGCG
AGCAGCACCTTGAGATACTGAGGAACAACTTTGAAGTACCTCCGACGAGTGAGACCTTCATCTCCCCGCT
ACAATCCTACTCCCAAGAGTATGATGGGAAATTAGTAAGACTTACAGCCAGTCCAGGCACCATGAATGAG
CTGTCTAAAATTGGAGTAACTGCAAATTCCGGAACCGGCCTATTGCTTCCAGATCTCCCTCCCGCCCGAA
AGGGCTGGAAACAGAACAACGCACTATTCAAACTCGAAGCACTAAAAAAGCCAACGATAAATGAAGGAGG
CGGCGTTATCAACACTGGCCTTGGGGATGGAAAAGCCCTAGAGATTTTCAACAAGAACCTAATAGACTTC
GAAGTAATAGACTAG

Reference
(1) Hachani A et al. (2014). The VgrG proteins are "A la carte" delivery systems for bacterial type VI effectors. J Biol Chem. 289(25):17872-17884. [PudMed:24794869] experimental
(2) Jones C et al. (2013). An rhs-encoding gene linked to the second type VI secretion cluster is a feature of the Pseudomonas aeruginosa strain PA14. J Bacteriol. 196(4):800-10. [PudMed:24317402] experimental
 
experimental experimental literature